BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.4 [Aug-26-2002]
Query= IGU001_0046_H05.f
         (578 letters)

Database: nr-aa 
           1,542,475 sequences; 498,469,568 total letters

Searching..................................................done

                                                                 Score    E

prf:2312242A      hemoglobin - Daphnia magna>prf:2512352A      h...   336   2e-91   Daphnia magna
prf:2512352C      hemoglobin - Daphnia magna>gp:AB021134_1 [AB02...   330   9e-90   Daphnia magna
gp:AF441753_1 [AF441753] gi:20513976  2-domain hemoglobin protei...   291   3e-78   Daphnia spinulata
gp:AF441751_1 [AF441751] gi:20513972  2-domain hemoglobin protei...   291   3e-78   Daphnia spinulata
gp:AF441748_1 [AF441748] gi:20513966  2-domain hemoglobin protei...   291   3e-78   Daphnia spinulata
gp:AF441742_1 [AF441742] gi:20513954  2-domain hemoglobin protei...   291   4e-78   Daphnia spinulata
gp:AF441740_1 [AF441740] gi:20513950  2-domain hemoglobin protei...   291   4e-78   Daphnia spinulata
gp:AF441747_1 [AF441747] gi:20513964  2-domain hemoglobin protei...   291   4e-78   Daphnia spinulata
gp:AF441756_1 [AF441756] gi:20513982  2-domain hemoglobin protei...   290   1e-77   Daphnia exilis
gp:AF441754_1 [AF441754] gi:20513978  2-domain hemoglobin protei...   290   1e-77   Daphnia spinulata
gp:AF441749_1 [AF441749] gi:20513968  2-domain hemoglobin protei...   290   1e-77   Daphnia spinulata
gp:AF441743_1 [AF441743] gi:20513956  2-domain hemoglobin protei...   289   2e-77   Daphnia spinulata
gp:AF441755_1 [AF441755] gi:20513980  2-domain hemoglobin protei...   288   3e-77   Daphnia exilis
gp:AF441752_1 [AF441752] gi:20513974  2-domain hemoglobin protei...   288   3e-77   Daphnia spinulata
gp:AF074722_1 [AF074722] gi:5881967  di-domain hemoglobin precur...   288   4e-77   Daphnia pulex
gp:AF441744_1 [AF441744] gi:20513958  2-domain hemoglobin protei...   285   3e-76   Daphnia spinulata
gp:AF441746_1 [AF441746] gi:20513962  2-domain hemoglobin protei...   285   3e-76   Daphnia spinulata
gp:AF441745_1 [AF441745] gi:20513960  2-domain hemoglobin protei...   285   4e-76   Daphnia spinulata
prf:2512352B      hemoglobin - Daphnia magna>gp:AB021134_3 [AB02...   281   6e-75   Daphnia magna
gp:AF441741_1 [AF441741] gi:20513952  2-domain hemoglobin protei...   276   1e-73   Daphnia spinulata
gp:AB055115_1 [AB055115] gi:15080671  hemoglobin chain [Moina ma...   240   1e-62   Moina macrocopa
gp:AB055114_1 [AB055114] gi:15080669  hemoglobin chain [Moina ma...   240   1e-62   Moina macrocopa
gp:AB055113_1 [AB055113] gi:15080667  hemoglobin chain [Moina ma...   239   2e-62   Moina macrocopa
gp:AF255951_1 [AF255951] gi:7650499  hemoglobin [Daphnia magna]       224   9e-58   Daphnia magna
prf:1703412A      polymeric globin - Artemia sp. (brine shrimp)        79   3e-14   Artemia sp.
pir:S13421 polymeric globin alpha - brine shrimp (fragment)            79   3e-14   Artemia sp.
gp:AF104217_1 [AF104217] gi:4020136  hemoglobin T1 polymer precu...    78   1e-13   Artemia salina
gp:AF258616_1 [AF258616] gi:8101728  hemoglobin P polymer precur...    68   8e-11   Parartemia zietziana
gp:AF104216_1 [AF104216] gi:4020134  hemoglobin C1 polymer precu...    67   2e-10   Artemia salina
gp:TNI315608_1 [AJ315608] gi:15387694  neuroglobin [Tetraodon ni...    66   4e-10   Tetraodon nigroviridis
spu:HBBC_ANGAN Hemoglobin cathodic, beta chain.>sp:HBBC_ANGAN He...    61   1e-08   Anguilla anguilla [European freshwater eel]
gpu:BC076983_1 [BC076983] gi:49903543  Unknown (protein for MGC:...    61   1e-08   Xenopus (Silurana) tropicalis
spu:HBB_TRENE Hemoglobin beta-1/2 chain.>sp:HBB_TRENE Hemoglobin...    60   2e-08   Trematomus newnesi
spu:GLBD_CAUAR Globin D, coelomic.>sp:GLBD_CAUAR Globin D, coelo...    60   2e-08   Caudina arenicola
sp:HBB2_XENLA Hemoglobin beta-2 chain (Minor) (Larval beta-II-gl...    60   2e-08   Xenopus laevis [clawed frog]
spu:CYGB_MOUSE Cytoglobin (Histoglobin) (HGb).>sp:CYGB_MOUSE Cyt...    60   2e-08   Mus musculus [mouse]
pir:A54492 hemoglobin beta-II chain, larval - African clawed fro...    60   2e-08   Xenopus laevis [clawed frog]
pir:S15979 hemoglobin beta chain - sea cucumber (Caudina arenico...    60   3e-08   Caudina arenicola
spu:CYGB_HUMAN Cytoglobin (Histoglobin) (HGb) (Stellate cell act...    59   4e-08   Homo sapiens [man]
gp:BC029798_1 [BC029798] gi:20987458  Unknown (protein for MGC:3...    59   5e-08   Homo sapiens [man]
spu:CYGB_RAT Cytoglobin (Histoglobin) (HGb) (Stellate cell activ...    59   5e-08   Rattus norvegicus [brown rat]
pir:HBXLT1 hemoglobin beta-T1 chain, tadpole - African clawed frog     59   6e-08   Xenopus laevis [clawed frog]
gp:AF291834_1 [AF291834] gi:9930592  myoglobin [Sarda chiliensis]      59   6e-08   Sarda chiliensis
gp:AF291832_1 [AF291832] gi:9930588  myoglobin [Thunnus alalunga]      59   6e-08   Thunnus alalunga
prf:0908250A      globin beta - Xenopus laevis (African clawed f...    59   6e-08   Xenopus laevis [clawed frog]
spu:MYG_THUTH Myoglobin.>sp:MYG_THUTH Myoglobin.                       58   1e-07   Thunnus thynnus [bluefin tuna]
gp:AK087408_1 [AK087408] gi:26352464  Mus musculus 0 day neonate...    58   1e-07   Mus musculus [mouse]
gp:AF291831_1 [AF291831] gi:9930586  myoglobin [Thunnus thynnus ...    58   1e-07   Thunnus thynnus thynnus
spu:MYG_THUAL Myoglobin.>sp:MYG_THUAL Myoglobin.>pir:MYTUY myogl...    57   1e-07   Thunnus albacares
gp:AF291838_1 [AF291838] gi:9930600  myoglobin [Thunnus albacares]     57   1e-07   Thunnus albacares
sp:HBB_TREHA Hemoglobin beta chain.                                    57   2e-07   Trematomus hansoni
sp:HBB2_TRENE Hemoglobin beta chain.                                   57   2e-07   Trematomus newnesi
gpu:BC075313_1 [BC075313] gi:49670685  Unknown (protein for MGC:...    57   2e-07   Xenopus (Silurana) tropicalis
prf:2420495F      hemoglobin:SUBUNIT=beta - Trematomus hansoni>g...    57   2e-07   Trematomus hansoni
prf:2420495D      hemoglobin:SUBUNIT=beta - Trematomus newnesi>g...    57   2e-07   Trematomus newnesi
sp:HBBL_XENLA Hemoglobin beta-1 larval chain.>prf:1012303A      ...    56   3e-07   Xenopus laevis [clawed frog]
gp:AF291833_1 [AF291833] gi:9930590  myoglobin [Makaira nigricans]     56   3e-07   Makaira nigricans
pir:I51600 hemoglobin beta-1 chain - African clawed frog>gp:XLBG...    56   3e-07   Xenopus laevis [clawed frog]
prf:2407323D      ctt-11 gene - Chironomus thummi thummi>gp:AF00...    55   5e-07   Chironomus thummi thummi
pir:B56898 hemoglobin beta chain - Bathydraco marri>prf:1905253B...    55   5e-07   Bathydraco marri
spu:HBB_LEIXA Hemoglobin beta chain.>sp:HBB_LEIXA Hemoglobin bet...    55   5e-07   Leiostomus xanthurus [spot]
spu:HBB1_PAGBO Hemoglobin beta-1 chain (HB 1).>sp:HBB1_PAGBO Hem...    55   7e-07   Pagothenia borchgrevinki
prf:2420495B      hemoglobin:SUBUNIT=beta - Pagothenia borchgrev...    55   7e-07   Pagothenia borchgrevinki
prf:1810391A      hemoglobin:ISOTYPE=1 - Pagothenia bernacchii (...    55   9e-07   Trematomus bernacchii [rockcod]
sp:HBBY_MESAU Hemoglobin beta-Y chain.                                 55   9e-07   Mesocricetus auratus [Syrian golden hamster]
spu:HBB_PAGBE Hemoglobin beta chain.>sp:HBB_PAGBE Hemoglobin bet...    55   9e-07   Trematomus bernacchii [rockcod]
prf:2420495E      hemoglobin:SUBUNIT=beta - Trematomus bernacchi...    55   9e-07   Trematomus bernacchii [rockcod]
pir:S22357 hemoglobin beta-y chain, embryonic - golden hamster>p...    55   9e-07   Mesocricetus auratus [Syrian golden hamster]
prf:2206405B      hemoglobin:SUBUNIT=epsilon1 - Rattus norvegicu...    54   1e-06   Rattus norvegicus [brown rat]
spu:HBBC_CONCO Hemoglobin cathodic, beta chain.                        54   1e-06   Conger conger
spu:GLB1_PARCH Globin I.>sp:GLB1_PARCH Globin I.>pir:S06134 hemo...    54   1e-06   Paracaudina chilensis
gpu:BC077014_1 [BC077014] gi:49900147  Unknown (protein for MGC:...    54   1e-06   Xenopus (Silurana) tropicalis
gp:RNEP1GE_1 [X56326] gi:3367724  epsilon 1 globin [Rattus norve...    54   1e-06   Rattus norvegicus [brown rat]
prf:2420495A      hemoglobin:SUBUNIT=beta - Cygnodraco mawsoni>g...    54   1e-06   Cygnodraco mawsoni [Antarctic dragonfish]
gpu:AJ628044_1 [AJ628044] gi:42661496  myoglobin [Tetraodon nigr...    54   2e-06   Tetraodon nigroviridis
spu:NGB2_ONCMY Neuroglobin 2.                                          54   2e-06   Oncorhynchus mykiss
gp:AY029587_1 [AY029587] gi:13989950  myoglobin [Hemitripterus a...    54   2e-06   Hemitripterus americanus
spu:HBB1_CYGMA Hemoglobin beta-1 chain.>sp:HBB1_CYGMA Hemoglobin...    54   2e-06   Cygnodraco mawsoni [Antarctic dragonfish]
gp:AF082662_1 [AF082662] gi:3676660  embryonic 1 beta-globin [Da...    54   2e-06   Danio rerio [leopard danio]
spu:HBBC_HOPLI Hemoglobin cathodic, beta chain (Hb(Ca) beta chai...    53   3e-06   Hoplosternum littorale [brown hoplo]
pir:HBMSH0 hemoglobin beta-h0 chain - mouse>gp:MUSHBBH0_1 [J0041...    53   3e-06   Mus musculus [mouse]
prf:1402327A      beta globin - Xenopus tropicalis (western claw...    53   3e-06   Xenopus (Silurana) tropicalis
spu:GLBZ_CHITH Globin CTT-Z precursor (HBZ).>sp:GLBZ_CHITH Globi...    53   3e-06   Chironomus thummi thummi
sp:HBB2_XENTR Hemoglobin beta-2 chain (Larval).                        52   5e-06   Xenopus (Silurana) tropicalis
pir:HBXLLW hemoglobin beta chain, larval - western clawed frog>g...    52   5e-06   Xenopus (Silurana) tropicalis
gpu:BC053176_1 [BC053176] gi:31419195  ba1 protein [Danio rerio]       52   6e-06   Danio rerio [leopard danio]
gp:AB034642_1 [AB034642] gi:6230896  beta hemoglobin B [Seriola ...    52   6e-06   Seriola quinqueradiata [five-ray yellowtail]
sp:HBB0_MOUSE Hemoglobin beta-H0 chain.                                52   6e-06   Mus musculus [mouse]
spu:HBE_MOUSE Hemoglobin epsilon-Y2 chain.>sp:HBE_MOUSE Hemoglob...    52   6e-06   Mus musculus [mouse]
spu:GLBC_CAUAR Globin C, coelomic.>sp:GLBC_CAUAR Globin C, coelo...    52   6e-06   Caudina arenicola
pir:A53881 hemoglobin chain C - sea cucumber (Caudina arenicola)...    52   6e-06   Caudina arenicola
sp:GLBZ_CHITP Globin CTT-Z precursor (HBZ).>pir:S21632 hemoglobi...    52   6e-06   Chironomus piger
gp:AB063101_2 [AB063101] gi:17529638  beta globin type-2 [Cyprin...    52   6e-06   Cyprinus carpio [carp]
gp:MMBGCXD_2 [X14061] gi:1183930  haemoglobin beta-h0 chain [Mus...    52   6e-06   Mus musculus [mouse]
pir:HEMSY2 hemoglobin epsilon-y2 chain - mouse>prf:0802170A     ...    52   6e-06   Mus musculus [mouse]
sp:HBBB_SERQU Hemoglobin beta-B chain.                                 52   6e-06   Seriola quinqueradiata [five-ray yellowtail]
sp:GLBV_CHITP Globin CTT-V precursor (HBV).>pir:S21633 hemoglobi...    52   8e-06   Chironomus piger
spu:GLB6_CHITH Globin CTT-VI precursor.>sp:GLB6_CHITH Globin CTT...    51   1e-05   Chironomus thummi thummi
gpu:AB154423_1 [AB154423] gi:48843364  myoglobin [Auxis rochei]        51   1e-05   Auxis rochei [bullet tuna]
gp:DRU50380_1 [U50380] gi:1477575  bA1 globin [Danio rerio]>gpu:...    50   2e-05   Danio rerio [leopard danio]
gp:DRU50379_1 [U50379] gi:1477573  bA2 globin [Danio rerio]>gpu:...    50   2e-05   Danio rerio [leopard danio]
gp:AK012501_1 [AK012501] gi:12849289  Mus musculus 11 days embry...    50   2e-05   Mus musculus [mouse]
gpu:AY450927_1 [AY450927] gi:42415679  epsilon globin [Macropus ...    50   3e-05   Macropus eugenii
prf:1004285A      globin betah0 - Mus musculus (house mouse)           50   3e-05   Mus musculus [mouse]
sp:HBBA_SERQU Hemoglobin beta-A chain.>gp:AB034641_1 [AB034641] ...    50   3e-05   Seriola quinqueradiata [five-ray yellowtail]
spu:MYG_MUSAN Myoglobin.>sp:MYG_MUSAN Myoglobin.>prf:0610174A   ...    50   3e-05   Mustelus antarcticus
spu:GLB2_CHITH Globin CTT-II beta precursor.>sp:GLB2_CHITH Globi...    49   4e-05   Chironomus thummi thummi
spu:HBB_GYMAC Hemoglobin beta chain.>sp:HBB_GYMAC Hemoglobin bet...    49   4e-05   Gymnodraco acuticeps
prf:2221402A      myoglobin - Aphrodita aculeata>gp:AAU46754_1 [...    49   4e-05   Aphrodita aculeata
gp:AF528160_1 [AF528160] gi:22135546  beta globin [Ctenopharyngo...    49   4e-05   Ctenopharyngodon idella
prf:2420495C      hemoglobin:SUBUNIT=beta - Gymnodraco acuticeps...    49   4e-05   Gymnodraco acuticeps
gp:D88116_1 [D88116] gi:1644253  beta-globin [Cyprinus carpio]         49   5e-05   Cyprinus carpio [carp]
prf:1922037A      myoglobin - Caretta caretta (loggerhead)             49   5e-05   Caretta caretta [loggerhead]
spu:MYG_CARCR Myoglobin.>sp:MYG_CARCR Myoglobin.                       49   5e-05   Caretta caretta [loggerhead]
pir:HBPT hemoglobin beta chain - potoroo (tentative sequence)          49   5e-05   Potorous tridactylus [long-nosed rat kangaroo]
spu:HBB_POTTR Hemoglobin beta chain.>sp:HBB_POTTR Hemoglobin bet...    49   5e-05   Potorous tridactylus [long-nosed rat kangaroo]
spu:HBB_STROE Hemoglobin beta chain.>pir:S55248 hemoglobin beta ...    49   5e-05   Streptopelia orientalis
pir:MYTTG myoglobin - green seaturtle (tentative sequence)             49   7e-05   Chelonia mydas
spu:MYG_CHEMY Myoglobin.>sp:MYG_CHEMY Myoglobin.>prf:0902173A   ...    49   7e-05   Chelonia mydas
spu:HBG2_HYLLA Hemoglobin gamma-2 chain.                               49   7e-05   Hylobates lar [white-handed gibbon]
gp:AF528200_1 [AF528200] gi:22135560  beta globin [Misgurnus ang...    49   7e-05   Misgurnus anguillicaudatus [dojo loach]
gp:RNEP2GL_1 [X56327] gi:4539553  epsilon 2 globin [Rattus norve...    49   7e-05   Rattus norvegicus [brown rat]
pir:I37036 hemoglobin gamma-2 chain - common gibbon>gp:GIBHBGGL_...    49   7e-05   Hylobates lar [white-handed gibbon]
spu:HBB_CARAU Hemoglobin beta chain.>sp:HBB_CARAU Hemoglobin bet...    48   9e-05   Carassius auratus
gp:AB004740_1 [AB004740] gi:2208895  beta-globin [Cyprinus carpio]     48   9e-05   Cyprinus carpio [carp]
spu:HBF1_URECA Hemoglobin F-I.>sp:HBF1_URECA Hemoglobin F-I.>prf...    48   9e-05   Urechis caupo
pir:A25537 globin F-I - spoonworm (Urechis caupo)>gp:UUNHBFI_1 [...    48   9e-05   Urechis caupo
spu:MYG_GOBGI Myoglobin.>sp:MYG_GOBGI Myoglobin.                       48   1e-04   Gobionotothen gibberifrons
spu:MYG_PSEGE Myoglobin.>sp:MYG_PSEGE Myoglobin.                       48   1e-04   Pseudochaenichthys georgianus
gp:PGU71055_1 [U71055] gi:10312067  myoglobin [Pseudochaenichthy...    48   1e-04   Pseudochaenichthys georgianus
gp:GGU71057_1 [U71057] gi:10312071  myoglobin [Gobionotothen gib...    48   1e-04   Gobionotothen gibberifrons
gp:AF361744_1 [AF361744] gi:19880109  hemoglobin [Yoldia eightsi]      48   1e-04   Yoldia eightsi
prf:0511279A      hemoglobin CTTVI - Chironomus thummi thummi          48   1e-04   Chironomus thummi thummi
pir:GGICE6 globin CTT-VI - midge (Chironomus thummi thummi) (ten...    48   1e-04   Chironomus thummi thummi
pir:GGICE2 globin CTT-II beta - midge (Chironomus thummi thummi)...    47   1e-04   Chironomus thummi thummi
prf:2403307A      globin:SUBUNIT=beta - Oncorhynchus mykiss (rai...    47   1e-04   Oncorhynchus mykiss
spu:HBB_APUAP Hemoglobin beta chain.>sp:HBB_APUAP Hemoglobin bet...    47   1e-04   Apus apus [Eurasian swift]
spu:HBB_PSIKR Hemoglobin beta chain.>sp:HBB_PSIKR Hemoglobin bet...    47   1e-04   Psittacula krameri
spu:HBB2_CYGMA Hemoglobin beta-2 chain.>sp:HBB2_CYGMA Hemoglobin...    47   1e-04   Cygnodraco mawsoni [Antarctic dragonfish]
prf:1312301E      globin E - Chironomus thummi thummi                  47   1e-04   Chironomus thummi thummi
spu:GLBX_CHITH Globin CTT-X.>sp:GLBX_CHITH Globin CTT-X.>pir:GGI...    47   1e-04   Chironomus thummi thummi
prf:2415425L      globin:ISOTYPE=Cpa E - Chironomus pallidivitta...    47   1e-04   Chironomus pallidivittatus
sp:GLBP_CHITH Globin CTT-E/E' precursor.>prf:2415425E      globi...    47   1e-04   Chironomus thummi thummi
gp:AF528161_1 [AF528161] gi:22135548  beta globin [Cyprinus carpio]    47   1e-04   Cyprinus carpio [carp]
gp:AF528158_1 [AF528158] gi:22135542  beta globin [Paramisgurnus...    47   1e-04   Paramisgurnus dabryanus
gp:AF291835_1 [AF291835] gi:9930594  myoglobin [Scomber japonicus]     47   1e-04   Scomber japonicus [Spanish mackerel]
gp:AK012495_1 [AK012495] gi:12849279  Mus musculus 11 days embry...    47   1e-04   Mus musculus [mouse]
gp:AK011619_1 [AK011619] gi:12847862  Mus musculus 10 days embry...    47   1e-04   Mus musculus [mouse]
gp:NCU71058_1 [U71058] gi:10312073  myoglobin [Notothenia coriic...    47   2e-04   Notothenia coriiceps [yellowbelly rockcod]
prf:2220343B      hemoglobin:SUBUNIT=beta - Decapterus maruadsi        47   2e-04   Decapterus maruadsi
pir:I37035 hemoglobin gamma-1 chain - common gibbon>gp:GIBHBGGL_...    47   2e-04   Hylobates lar [white-handed gibbon]
pir:HGMQR hemoglobin gamma-1 chain - rhesus macaque>gp:MACHBGA2_...    47   2e-04   Macaca mulatta [rhesus macaque]
sp:HBB_DECMA Hemoglobin beta chain.>gp:S83542_1 [S83542] gi:1324...    47   2e-04   Decapterus maruadsi
gp:D88117_1 [D88117] gi:1644255  beta-globin [Cyprinus carpio]         47   2e-04   Cyprinus carpio [carp]
gp:AF291837_1 [AF291837] gi:9930598  myoglobin [Katsuwonus pelamis]    47   2e-04   Katsuwonus pelamis [bonito]
spu:HBG_MACMU Hemoglobin gamma chain.>sp:HBG_MACMU Hemoglobin ga...    47   2e-04   Macaca mulatta [rhesus macaque]
spu:HBG1_HYLLA Hemoglobin gamma-1 chain.>sp:HBG_HYLLA Hemoglobin...    47   2e-04   Hylobates lar [white-handed gibbon]
spu:HBG_MACNE Hemoglobin gamma chain.>sp:HBG_MACNE Hemoglobin ga...    47   2e-04   Macaca nemestrina [pigtail macaque]
spu:MYG_NOTCO Myoglobin.>sp:MYG_NOTCO Myoglobin.                       47   2e-04   Notothenia neglecta [Antarctic yellowbelly rockcod]
pir:GGGACR globin - horn shell (Cerithidea rhizophorarum) (tenta...    47   2e-04   Cerithidea rhizophorarum [horn shell]
spu:GLB_CERRH Globin (Myoglobin).>sp:GLB_CERRH Globin (Myoglobin...    47   2e-04   Cerithidea rhizophorarum [horn shell]
spu:MYG_GRAGE Myoglobin.>sp:MYG_GRAGE Myoglobin.>pir:MYTTM myogl...    47   2e-04   Graptemys geographica
pir:S41625 hemoglobin beta chain - Atlantic salmon>prf:2009340A ...    47   2e-04   Salmo salar
spu:MYG_GALGA Myoglobin.>sp:MYG_GALGA Myoglobin.>prf:0710196A   ...    47   2e-04   Galeorhinus galeus
pir:S14574 globin C precursor - midge (Chironomus tentans)>gp:CT...    47   2e-04   Chironomus tentans
gpu:BX572605_1 [BX572605] gi:39650628  possible hemoprotein [Rho...    47   2e-04   Rhodopseudomonas palustris CGA009
sp:HBG_RABIT Hemoglobin gamma chain (Beta-3).                          47   2e-04   Oryctolagus cuniculus [domestic rabbit]
spu:HBG_HUMAN Hemoglobin gamma-A and gamma-G chains.>spu:HBG1_PA...    47   2e-04   Homo sapiens [man]
pir:HBRB3 hemoglobin gamma chain - rabbit>prf:0712221A      glob...    47   2e-04   Oryctolagus cuniculus [domestic rabbit]
pir:HGHUA hemoglobin gamma-A chain [validated] - human>pir:HGCZA...    47   2e-04   Homo sapiens [man]
sp:HBB_SALSA Hemoglobin beta chain.                                    47   2e-04   Salmo salar
gpu:AX888129_1 [AX888129] gi:40046982  Sequence 3992 from Patent...    46   3e-04   Homo sapiens [man]
gp:AY014769_1 [AY014769] gi:13124832  omega globin [Macropus eug...    46   3e-04   Macropus eugenii
pir:I37002 hemoglobin gamma chain - pygmy chimpanzee>gp:CHPPHYGE...    46   3e-04   Pan paniscus [bonobo]
pir:HGMQR2 hemoglobin gamma-2 chain - rhesus macaque>gp:MACHBGA1...    46   3e-04   Macaca mulatta [rhesus macaque]
pir:I37022 hemoglobin gamma-A chain - gorilla>gp:GGAGGLOG_1 [X03...    46   3e-04   Gorilla gorilla gorilla [lowland gorilla]
sp:HBB_ONCNE Hemoglobin beta chain.                                    46   3e-04   Oncorhynchus nerka
gpu:AY190698_1 [AY190698] gi:37779026  beta-globin [Pagrus major]      46   3e-04   Pagrus major [red tail]
gp:D88115_1 [D88115] gi:1644251  beta-globin [Cyprinus carpio]>g...    46   3e-04   Cyprinus carpio [carp]
gp:AY026061_1 [AY026061] gi:13124852  beta globin subunit [Oncor...    46   3e-04   Oncorhynchus nerka
spu:HBB_CICCI Hemoglobin beta chain.>sp:HBB_CICCI Hemoglobin bet...    46   3e-04   Ciconia ciconia
spu:HBB_ALDEL Hemoglobin A and D beta chain.>sp:HBB_ALDEL Hemogl...    46   3e-04   Dipsochelys dussumieri [Aldabra tortoise]
spu:HBG_GORGO Hemoglobin gamma-A and gamma-G chains.>sp:HBG_GORG...    46   3e-04   Gorilla gorilla gorilla [lowland gorilla]
spu:MYG_CYPCA Myoglobin.>sp:MYG_CYPCA Myoglobin.>pir:MYCA myoglo...    46   3e-04   Cyprinus carpio [carp]
spu:HBB0_PAGBO Hemoglobin beta-0 chain (HB 0).>sp:HBB0_PAGBO Hem...    46   3e-04   Pagothenia borchgrevinki
spu:HBB_CERSI Hemoglobin beta chain.>sp:HBB_CERSI Hemoglobin bet...    46   3e-04   Ceratotherium simum [square-lipped rhinoceros]
sp:HBB1_XENLA Hemoglobin beta-1 chain (Major).>pir:HBXL hemoglob...    46   4e-04   Xenopus laevis [clawed frog]
gp:SSABGLOB1_2 [X97284] gi:1431593  beta-globin [Salmo salar]          46   4e-04   Salmo salar
pir:T01069 hemoglobin beta chain - Kenyan clawed frog>prf:090825...    46   4e-04   Xenopus borealis [Marasbit clawed frog]
spu:GLBT_CHITH Globin CTT-IIIA.>sp:GLBT_CHITH Globin CTT-IIIA.>p...    46   4e-04   Chironomus thummi thummi
spu:HBBA_ANGAN Hemoglobin anodic, beta chain.>sp:HBBA_ANGAN Hemo...    46   4e-04   Anguilla anguilla [European freshwater eel]
gp:AF528159_1 [AF528159] gi:22135544  beta globin [Carassius aur...    45   6e-04   Carassius auratus
gp:RNBHORA_1 [X60729] gi:1419183  beta-globin chain [Rattus norv...    45   6e-04   Rattus norvegicus [brown rat]
gp:TGLHBB_1 [L23800] gi:438907  beta-globin homolog [Tachyglossu...    45   6e-04   Tachyglossus aculeatus [short-beaked echidna]
prf:2311496A      myoglobin - Chionodraco rastrospinosus>gp:CRU7...    45   6e-04   Chionodraco rastrospinosus
prf:1603302A      gamma globin - Hylobates lar (common gibbon)         45   6e-04   Hylobates lar [white-handed gibbon]
pir:A27800 hemoglobin gamma-1 chain - orangutan>gp:ORAGM12GLB_1 ...    45   6e-04   Pongo pygmaeus [orang utan]
pir:HBRB4 hemoglobin epsilon chain - rabbit>prf:0908261A      gl...    45   6e-04   Oryctolagus cuniculus [domestic rabbit]
sp:HBE_RABIT Hemoglobin epsilon chain (Beta-4).                        45   6e-04   Oryctolagus cuniculus [domestic rabbit]
spu:MYG_CHIRA Myoglobin.>sp:MYG_CHIRA Myoglobin.                       45   6e-04   Chionodraco rastrospinosus
spu:HBB_TACAC Hemoglobin beta chain.>sp:HBB_TACAC Hemoglobin bet...    45   6e-04   Tachyglossus aculeatus aculeatus
spu:HBG1_PONPY Hemoglobin gamma-1 chain.>sp:HBG1_PONPY Hemoglobi...    45   6e-04   Pongo pygmaeus [orang utan]
gp:CAU71056_1 [U71056] gi:10312069  myoglobin [Cryodraco antarct...    45   7e-04   Cryodraco antarcticus
gp:AF072681_1 [AF072681] gi:3283984  gamma globin [Tarsius banca...    45   7e-04   Tarsius bancanus [Western tarsier]
pir:HBTR4 hemoglobin IV beta chain - rainbow trout (tentative se...    45   7e-04   Oncorhynchus mykiss
pir:HGHUG hemoglobin gamma-G chain [validated] - human>pir:HGCZG...    45   7e-04   Homo sapiens [man]
spu:HBB_ELEEL Hemoglobin beta chain.>sp:HBB_ELEEL Hemoglobin bet...    45   7e-04   Electrophorus electricus [electric knifefish]
spu:HBB4_ONCMY Hemoglobin beta-IV chain.>sp:HBB4_ONCMY Hemoglobi...    45   7e-04   Oncorhynchus mykiss
gp:XELBETAA_1 [M32456] gi:213975  X.borealis beta-I globin mRNA,...    45   7e-04   Xenopus borealis [Marasbit clawed frog]
sp:HBG_TARBA Hemoglobin gamma chain.                                   45   7e-04   Tarsius bancanus [Western tarsier]
spu:HBG2_PANTR Hemoglobin gamma-G chain (Hemoglobin gamma-2).>pr...    45   7e-04   Pan troglodytes
spu:MYG_CRYAN Myoglobin.>sp:MYG_CRYAN Myoglobin.                       45   7e-04   Cryodraco antarcticus
gp:HUMHBGG_1 [M15386] gi:183885  hemoglobin gamma-G [Homo sapiens]     45   7e-04   Homo sapiens [man]
prf:2415425J      globin:ISOTYPE=Cpa 4-1 - Chironomus pallidivit...    45   7e-04   Chironomus pallidivittatus
spu:GLB8_CHITH Globin CTT-VIII.>sp:GLB8_CHITH Globin CTT-VIII.>p...    45   7e-04   Chironomus thummi thummi
sp:HBB1_XENBO Hemoglobin beta-1 chain (Major).>pir:E25929 hemogl...    45   7e-04   Xenopus borealis [Marasbit clawed frog]
spu:HBB2_TELPE Hemoglobin beta-2 chain.                                45   0.001   Telmatobius peruvianus
spu:HBG2_PONPY Hemoglobin gamma-2 chain.>sp:HBG2_PONPY Hemoglobi...    45   0.001   Pongo pygmaeus [orang utan]
spu:HBB_DIDMA Hemoglobin beta-M chain.>sp:HBB_DIDMA Hemoglobin b...    45   0.001   Didelphis virginiana [Virginia opossum]
gpu:AY450928_1 [AY450928] gi:42415681  beta globin [Macropus eug...    45   0.001   Macropus eugenii
gp:AB034757_1 [AB034757] gi:6329445  larval beta-globin [Hynobiu...    45   0.001   Hynobius retardatus [Yeso salamander]
gp:ORAGM12GLB_2 [M92296] gi:342822  gamma-2 globin [Pongo pygmae...    45   0.001   Pongo pygmaeus [orang utan]
gp:BC010913_1 [BC010913] gi:15012032  Similar to hemoglobin, gam...    45   0.001   Homo sapiens [man]
pir:HBOP hemoglobin beta chain - North American opossum>prf:1408...    45   0.001   Didelphis virginiana [Virginia opossum]
prf:0812199A      globin beta-like y - Mus musculus (house mouse)      44   0.001   Mus musculus [mouse]
pir:JC7791 myoglobin - thick-billed murre                              44   0.001   Uria lomvia
gp:D88119_1 [D88119] gi:1644259  beta-globin [Cyprinus carpio]         44   0.001   Cyprinus carpio [carp]
gp:UCU30878_1 [U30878] gi:945056  F-I hemoglobin [Urechis caupo]       44   0.001   Urechis caupo
spu:GLB1_ARTSX Globin E1, extracellular.>sp:GLB1_ARTSX Globin E1...    44   0.002   Artemia sp.
sp:HBP2_CASGL Hemoglobin II.>pir:S13378 hemoglobin II - swamp oa...    44   0.002   Casuarina glauca
pir:A28141 globin, extracellular - brine shrimp (fragment)             44   0.002   Artemia sp.
prf:0505220B      hemoglobin beta - Didelphis virginiana (North ...    44   0.002   Didelphis virginiana [Virginia opossum]
spu:HBB_PASMO Hemoglobin beta chain.>sp:HBB_PASMO Hemoglobin bet...    44   0.002   Passer montanus [tree sparrow]
spu:HBB_STUVU Hemoglobin beta chain.>sp:HBB_STUVU Hemoglobin bet...    44   0.002   Sturnus vulgaris [starling]
spu:HBB_ACCGE Hemoglobin beta chain.>sp:HBB_ACCGE Hemoglobin bet...    44   0.002   Accipiter gentilis
pir:S61518 two-domain hemoglobin - blood clam (Barbatia lima)>gp...    44   0.002   Barbatia lima
gp:PMU71152_1 [U71152] gi:1809302  myoglobin [Pagetopsis macropt...    43   0.003   Pagetopsis macropterus
prf:1922276B      gamma globin - Tarsius sp. (tarsier)                 43   0.003   Tarsius sp.
prf:0707234A      globin beta-like rho - Gallus gallus (chicken)       43   0.003   Gallus gallus [bantam]
sp:HBG_CEBAP Hemoglobin gamma-1 and gamma-2 chains.>prf:1922276A...    43   0.003   Cebus apella [black-capped capuchin]
sp:HBB_GEOCR Hemoglobin beta chain.                                    43   0.003   Chelonoidis carbonaria
spu:HBB_GEONI Hemoglobin beta chain.>sp:HBB_GEONI Hemoglobin bet...    43   0.003   Chelonoidis nigra [Charles Island giant tortoise]
spu:HBB_PHACA Hemoglobin beta chain.>sp:HBB_PHACA Hemoglobin bet...    43   0.003   Phalacrocorax carbo
prf:2319207A      hemoglobin:SUBUNIT=beta - Geochelone carbonari...    43   0.003   Chelonoidis carbonaria
pir:G00014 hemoglobin gamma-1 chain - brown capuchin>gp:CAU57043...    43   0.003   Cebus apella [black-capped capuchin]
sp:HBL_MAIZE Non-symbiotic hemoglobin (Hbm) (ZEAma GLB1).>gp:AY0...    43   0.004   Zea mays [maize]
pir:S14575 globin D precursor - midge (Chironomus tentans)>gp:CT...    43   0.004   Chironomus tentans
spu:HBL1_ORYSA Non-symbiotic hemoglobin 1 (rHb1) (ORYsa GLB1a).>...    43   0.004   Oryza sativa [red rice]
sp:HBG_CHEME Hemoglobin gamma chain.                                   43   0.004   Cheirogaleus medius [fat-tailed dwarf lemur]
spu:HBB_PHACO Hemoglobin beta chain.>sp:HBB_PHACO Hemoglobin bet...    43   0.004   Phasianus colchicus colchicus
spu:HBB_PHORU Hemoglobin beta chain.>sp:HBB_PHORU Hemoglobin bet...    43   0.004   Phoenicopterus ruber ruber
gp:AY151389_1 [AY151389] gi:27085253  hemoglobin [Solanum tubero...    43   0.004   Solanum tuberosum [potatoes]
gp:AF110493_1 [AF110493] gi:4378748  hemoglobin gamma-G [Homo sa...    43   0.004   Homo sapiens [man]
gp:AF016991_1 [AF016991] gi:11320869  gamma2-globin [Callithrix ...    43   0.004   Callithrix jacchus [common marmoset]
gp:AY014770_1 [AY014770] gi:13124834  omega globin [Sminthopsis ...    43   0.004   Sminthopsis crassicaudata
pir:G00015 hemoglobin gamma-2 chain - brown capuchin>gp:CAU57045...    43   0.004   Cebus apella [black-capped capuchin]
pir:I77304 hemoglobin gamma chain - fat-tailed dwarf lemur>gp:LE...    43   0.004   Cheirogaleus medius [fat-tailed dwarf lemur]
pir:B27800 hemoglobin gamma-2 chain - orangutan                        43   0.004   Pongo pygmaeus [orang utan]
sp:HBL1_GOSHI Non-symbiotic hemoglobin 1 (Hb1) (GOShi GLB1).>gp:...    42   0.005   Gossypium hirsutum [American cotton]
gp:SCHBBHEMO_1 [Z69592] gi:1197379  hemoglobin adult beta-chain ...    42   0.005   Sminthopsis crassicaudata
pir:I77303 hemoglobin gamma chain - black lemur>gp:LEMHBG_1 [M15...    42   0.005   Eulemur macaco
pir:HGMKS hemoglobin gamma chain - black-handed spider monkey>gp...    42   0.005   Ateles geoffroyi [Central American spider monkey]
pir:JC5190 myoglobin - rhinoceros auklet                               42   0.005   Cerorhinca monocerata
pir:JT0636 myoglobin - whiskered auklet                                42   0.005   Aethia pygmaea
spu:MYG_VARVA Myoglobin.>sp:MYG_VARVA Myoglobin.>pir:MYLZM myogl...    42   0.005   Varanus varius
gp:HSGGGPHG_1 [X55656] gi:31725  gamma-G globin [Homo sapiens]>g...    42   0.005   Homo sapiens [man]
pir:S21403 hemoglobin gamma-G chain artifact - human (fragment)        42   0.005   Homo sapiens [man]
sp:HBG_EULFU Hemoglobin gamma chain.                                   42   0.005   Eulemur fulvus fulvus
sp:HBG_ATEGE Hemoglobin gamma chain.                                   42   0.005   Ateles geoffroyi [Central American spider monkey]
sp:HBB_SMICR Hemoglobin beta chain.                                    42   0.005   Sminthopsis crassicaudata
spu:HBB_ANSAN Hemoglobin beta chain.>sp:HBB_ANSAN Hemoglobin bet...    42   0.005   Anser anser anser
spu:HBB_LARRI Hemoglobin beta and beta' chains.>sp:HBB_LARRI Hem...    42   0.005   
sp:HBL_ZEAMP Non-symbiotic hemoglobin (Hbt) (ZEAmp GLB1).>gp:AF2...    42   0.005   Zea mays subsp. parviglumis [Balsas teosinte]
gpu:AC130603_18 [AC130603] gi:46575960  'unknown protein, contai...    42   0.005   Oryza sativa Japonica Group [Japonica rice]
spu:MYG_CASFI Myoglobin.>sp:MYG_CASFI Myoglobin.>pir:JN0410 myog...    42   0.006   Castor fiber
spu:MYG_GALJA Myoglobin.>sp:MYG_GALJA Myoglobin.>prf:1206204A   ...    42   0.006   Hemitriakis japanica
spu:HBB_TURME Hemoglobin beta chain.>sp:HBB_TURME Hemoglobin bet...    42   0.006   Turdus merula [Amsel]
spu:HBB_MACGI Hemoglobin beta chain.>sp:HBB_MACGI Hemoglobin bet...    42   0.006   Macropus giganteus
spu:HBG_AOTAZ Hemoglobin gamma chain.>sp:HBG_AOTAZ Hemoglobin ga...    42   0.006   Aotus azarai [Azara's owl monkey]
spu:HBB_CHEKU Hemoglobin beta chain.>sp:HBB_CHEKU Hemoglobin bet...    42   0.006   Chelidonichthys kumu [red gurnard]
gpu:AB119122_1 [AB119122] gi:34447126  globin M1 precursor [Haem...    42   0.006   
gp:AY026343_1 [AY026343] gi:12963875  non-symbiotic hemoglobin c...    42   0.006   
gp:AAU57044_1 [U57044] gi:1401187  gamma globin [Aotus azarai]         42   0.006   
prf:1111329A      globin gamma - Ateles geoffroyi (black-handed ...    42   0.006   
gp:AF016985_1 [AF016985] gi:11320863  hybrid gamma1/gamma2-globi...    42   0.008   
pir:A30213 hemoglobin epsilon chain - North American opossum>gp:...    42   0.008   
sp:HBE_DIDMA Hemoglobin epsilon-M chain.                               42   0.008   
spu:HBB_MACRU Hemoglobin beta chain.>sp:HBB_MACRU Hemoglobin bet...    42   0.008   
spu:HBB_CHRPI Hemoglobin beta chain.>sp:HBB_CHRPI Hemoglobin bet...    42   0.008   
prf:2415425G      globin:ISOTYPE=Cpa F - Chironomus pallidivitta...    42   0.008   
sp:HBG_ALOBE Hemoglobin gamma chain.                                   41   0.010   
spu:HBB_ANSIN Hemoglobin beta chain.>sp:HBB_ANSIN Hemoglobin bet...    41   0.010   
spu:HBB_AEGMO Hemoglobin beta chain.>sp:HBB_AEGMO Hemoglobin bet...    41   0.010   
sp:GLBW_CHITP Globin CTT-W precursor (HBW).>pir:S21634 hemoglobi...    41   0.010   
spu:GLBW_CHITH Globin CTT-W precursor (HBW).>sp:GLBW_CHITH Globi...    41   0.010   
gp:AF030095_1 [AF030095] gi:2707229  gamma hemoglobin [Alouatta ...    41   0.010   
gp:AF016983_1 [AF016983] gi:11320859  hybrid gamma1/gamma2-globi...    41   0.010   
gp:AF016984_1 [AF016984] gi:11320861  hybrid gamma1/gamma2-globi...    41   0.014   
spu:HBB_CYPCA Hemoglobin beta-A/1 and beta-B/2 chains.>sp:HBB_CY...    41   0.014   
spu:HBB_CATMA Hemoglobin beta chain.>sp:HBB_CATMA Hemoglobin bet...    41   0.014   
sp:HBL_HORVU Non-symbiotic hemoglobin (HORvu GLB1) (Nonlegume he...    41   0.014   
spu:HBB_COTJA Hemoglobin beta chain.>sp:HBB_COTJA Hemoglobin bet...    40   0.018   
spu:HBB_BRACA Hemoglobin beta chain.>sp:HBB_BRACA Hemoglobin bet...    40   0.018   
spu:HBB_STRCA Hemoglobin beta chain.>sp:HBB_STRCA Hemoglobin bet...    40   0.018   
spu:HBB_RHEAM Hemoglobin beta chain.>sp:HBB_RHEAM Hemoglobin bet...    40   0.018   
gp:AF157494_1 [AF157494] gi:5139299  hemoglobin [Myxine glutinosa]     40   0.018   
gp:CHKORF_1 [M73995] gi:212491  Gallus gallus mRNA, complete ORF...    40   0.018   
spu:HBB3_MURHE Hemoglobin beta-III chain.>pir:S67982 hemoglobin ...    40   0.018   
prf:2508222A      nonsymbiotic hemoglobin - Cichrorium intybus x...    40   0.023   
spu:HBB_VULGR Hemoglobin beta chain.>sp:HBB_VULGR Hemoglobin bet...    40   0.023   
spu:HBB_ANSSE Hemoglobin beta chain.>sp:HBB_ANSSE Hemoglobin bet...    40   0.023   
spu:HBB_CHICK Hemoglobin beta chain.>sp:HBB_CHICK Hemoglobin bet...    40   0.023   
spu:HBB_CHLME Hemoglobin beta chain.>sp:HBB_CHLME Hemoglobin bet...    40   0.023   
prf:1408288A      hemoglobin betaM - Didelphis sp.                     40   0.023   
pir:HBCH hemoglobin beta chain - chicken>prf:0904282A      globi...    40   0.023   
gp:AF030097_1 [AF030097] gi:2707233  gamma hemoglobin [Alouatta ...    40   0.030   
pir:HECH hemoglobin epsilon chain - chicken>prf:0911254A      gl...    40   0.030   
prf:1312301F      globin A' - Chironomus thummi thummi                 40   0.030   
gp:NCU68350_1 [U68350] gi:1592567  myoglobin [Notothenia coriiceps]    40   0.030   
prf:0802166B      hemoglobin M epsilon - Gallus gallus (chicken)       40   0.030   
sp:HBG_ALOSE Hemoglobin gamma chain.                                   40   0.030   
sp:HBB_ANAPL Hemoglobin beta chain.>pir:HBDK hemoglobin beta cha...    40   0.030   
spu:HBE_CHICK Hemoglobin epsilon chain.>sp:HBE_CHICK Hemoglobin ...    40   0.030   
spu:HBB_EUDCR Hemoglobin beta chain.>sp:HBB_EUDCR Hemoglobin bet...    40   0.030   
gp:CHIHBB1_1 [M17691] gi:156573  C.thummi thummi globin gene A' ...    40   0.030   
gp:AY151390_1 [AY151390] gi:27085255  hemoglobin Hb1 [Triticum a...    40   0.030   
prf:1312301B      globin B - Chironomus thummi thummi                  39   0.040   
pir:HBOR hemoglobin beta chain - duckbill platypus (tentative se...    39   0.040   
spu:HBB_ANAPP Hemoglobin beta chain.>sp:HBB_ANAPP Hemoglobin bet...    39   0.040   
spu:HBB_ORNAN Hemoglobin beta chain.>sp:HBB_ORNAN Hemoglobin bet...    39   0.040   
spu:GLB3_CHITH Globin CTT-III precursor (Erythrocruorin III).>sp...    39   0.040   
pir:I50248 hemoglobin beta-H chain - chicken>prf:2002270A      b...    39   0.040   
gpu:AY337025_1 [AY337025] gi:37695556  myoglobin [Danio rerio]         39   0.052   
gpu:BC056727_1 [BC056727] gi:34784042  hypothetical protein MGC6...    39   0.052   
gp:AY029506_1 [AY029506] gi:13876583  hemoglobin beta chain [Epi...    39   0.052   
pir:HFCHR hemoglobin rho chain - chicken>prf:0709277A      globi...    39   0.052   
prf:1312301A      globin A - Chironomus thummi thummi                  39   0.052   
spu:HBAZ_PIG Hemoglobin zeta chain.>sp:HBAZ_PIG Hemoglobin zeta ...    39   0.052   
spu:HBRH_CHICK Hemoglobin rho chain.>sp:HBRH_CHICK Hemoglobin rh...    39   0.052   
spu:HBB_FRAPO Hemoglobin beta chain.>sp:HBB_FRAPO Hemoglobin bet...    39   0.052   
gp:AP003336_12 [AP003336] gi:21328006  B1151H08.14 gene product ...    39   0.052   
prf:2415425A      globin:ISOTYPE=Ctt 3-1 - Chironomus thummi thu...    39   0.052   
sp:HBB_CAIMO Hemoglobin beta chain.>prf:0703209A      globin alp...    39   0.068   
pir:A39601 hemoglobin 35K chain - ark shell (Barbatia reeveana)>...    39   0.068   
pir:HBDKM hemoglobin beta chain - muscovy duck>prf:1603375A     ...    39   0.068   
prf:2203398A      hemoglobin - Barbatia lima>gp:BARH1_1 [D58417]...    38   0.089   
gp:AF184047_1 [AF184047] gi:5924295  hemoglobin [Myxine glutinosa]     38   0.089   
spu:GLB3_MYXGL Globin III.>sp:GLB3_MYXGL Globin III.>pir:GGHF3G ...    38   0.089   
spu:MYG_HETPO Myoglobin.>sp:MYG_HETPO Myoglobin.>pir:MYRKJ myogl...    38   0.089   
prf:0909303C      hemoglobin zeta - Sus scrofa domestica (domest...    38   0.089   
spu:HBB_AQUCH Hemoglobin beta chain.>sp:HBB_AQUCH Hemoglobin bet...    38   0.089   
gp:AB083078_4 [AB083078] gi:23496464  alpha-type globin [Oryzias...    38   0.12    
spu:HBAZ_HUMAN Hemoglobin zeta chain (HBAZ).>sp:HBAZ_HUMAN Hemog...    38   0.12    
gp:AL845551_3 [AL845551] gi:27802787  SI:bY119C3.2.2 (novel beta...    38   0.12    
spu:HBB2_SPHPU Hemoglobin beta-2 chain.>sp:HBB2_SPHPU Hemoglobin...    38   0.12    
gp:BARH_1 [D58416] gi:893361  hemoglobin (heterodimeric) [Barbat...    38   0.12    
pir:HZHU hemoglobin zeta chain [validated] - human>gp:AE006462_6...    38   0.12    
pir:S00838 hemoglobin - Trema tomentosa>prf:1402313A      hemogl...    37   0.15    
prf:1302222A      globin zeta - Capra aegagrus hircus (domestic ...    37   0.15    
gpu:AY286331_1 [AY286331] gi:30909306  nonsymbiotic hemoglobin [...    37   0.15    
sp:HBAZ_CAPHI Hemoglobin zeta chain.>pir:A25555 hemoglobin zeta ...    37   0.15    
gp:AF309562_1 [AF309562] gi:10764841  hemoglobin [Ceratodon purp...    37   0.15    
prf:1807352B      leghemoglobin I - Casuarina glauca (swamp oak)       37   0.15    
spu:HBP1_CASGL Hemoglobin I.>sp:HBP1_CASGL Hemoglobin I.>pir:GPU...    37   0.15    
sp:HBL1_ARATH Non-symbiotic hemoglobin 1 (Hb1) (ARAth GLB1).>pir...    37   0.20    
sp:HBL2_ORYSA Non-symbiotic hemoglobin 2 (rHb2) (ORYsa GLB1b).>p...    37   0.20    
prf:1409317C      globin zeta3 - Oryctolagus cuniculus (domestic...    37   0.20    
gp:DRU50382_1 [U50382] gi:1477579  beta globin [Danio rerio]           37   0.20    
gp:AF547166_1 [AF547166] gi:24266940  truncated myoglobin [Champ...    37   0.20    
gpu:AB119125_1 [AB119125] gi:34447132  globin D2 precursor [Haem...    37   0.20    
spu:GLB3_CHITP Globin CTP-III (Erythrocruorin III).>sp:GLB3_CHIT...    37   0.20    
prf:0503198A      hemoglobin CTTIII - Chironomus thummi thummi         37   0.26    
gp:AF081103_1 [AF081103] gi:3859941  putative gag-related protei...    36   0.34    
gpu:AB119124_1 [AB119124] gi:34447130  globin D1 precursor [Haem...    36   0.34    
gp:TVI131352_1 [AJ131352] gi:6599363  hemoglobin [Trema virgata]       36   0.34    
gp:TVI131349_1 [AJ131349] gi:6599357  hemoglobin [Trema virgata]       36   0.34    
sp:HBL_TRETO Non-symbiotic hemoglobin (TREto GLB1).>gp:TTHB_1 [Y...    36   0.44    
pir:HZCZ hemoglobin zeta-1 chain - chimpanzee>gp:PTAZGLO_1 [X032...    35   0.57    
spu:HBB1_TRICR Hemoglobin beta-1 chain (Hemoglobin beta-major ch...    35   0.57    
spu:HBPL_PARAD Nonlegume hemoglobin I.>sp:HBPL_PARAD Nonlegume h...    35   0.57    
sp:HBAZ_PANTR Hemoglobin zeta chain.                                   35   0.57    
prf:1102200A      hemoglobin I - Parasponia andersonii                 35   0.57    
pir:S33783 hemoglobin V - midge (Tokunagayusurika akamusi)             35   0.57    
sp:HBAZ_HORSE Hemoglobin zeta chain.                                   35   0.75    
gp:AF006611_1 [AF006611] gi:2723330  mutant myoglobin [Champsoce...    35   0.75    
pir:GPDRNL hemoglobin I - Parasponia andersonii>prf:1212354A    ...    35   0.75    
pir:S01019 hemoglobin I - Parasponia rigida                            35   0.75    
pir:S01714 hemoglobin zeta chain - horse>prf:1404348A      zeta ...    35   0.75    
gpu:AP003999_10 [AP003999] gi:50251710  unknown protein [Oryza s...    35   0.98    
gp:AF090112_1 [AF090112] gi:4138839  phospholipase C-gamma-1b [X...    35   0.98    
spu:HBAM_RANCA Hemoglobin alpha-type chain, heart muscle.>sp:HBA...    35   0.98    
gpu:BC068831_1 [BC068831] gi:46249596  LOC398359 protein [Xenopu...    35   0.98    
spu:SYN1_CANFA Synapsin I (Fragment).>sp:SYN1_CANFA Synapsin I (...    35   0.98    
pir:E82543 hypothetical protein XF2549 [imported] - Xylella fast...    34   1.3     
gp:TVI131350_1 [AJ131350] gi:6599359  hemoglobin [Trema virgata]...    34   1.3     
spu:HBB_CARCR Hemoglobin beta chain.>sp:HBB_CARCR Hemoglobin bet...    34   1.3     
gp:AB016767_1 [AB016767] gi:4239870  telomerase transcriptase [H...    34   1.3     
pir:S42045 hemoglobin - swamp oak>prf:2316436A      hemoglobin -...    34   1.3     
gpu:AY281355_20 [AY281355] gi:31789452  putative periplasmic pro...    34   1.3     
gp:AF027215_1 [AF027215] gi:3378095  hemoglobin [Trema orientalis]     34   1.7     
gp:AF258810_1 [AF258810] gi:10764218  aldehyde oxidase [Lycopers...    34   1.7     
sp:YEXN_AERSA Hypothetical transcriptional regulator in exeN 3'r...    34   1.7     
sp:DSR6_HUMAN Down syndrome critical region protein 6.>gp:AB0371...    34   1.7     
pir:H95964 probable outer membrane secretion protein SMb21543 [i...    34   1.7     
gp:BC036187_1 [BC036187] gi:23274133  Similar to serine/arginine...    33   2.2     
gp:AP005947_186 [AP005947] gi:27351697  blr3438 gene product [Br...    33   2.2     
prf:2413299A      SRm160 protein - Homo sapiens (man)>gp:AF04897...    33   2.2     
pir:S42044 hemoglobin - swamp oak>gp:CGSYMA_1 [X77694] gi:454918...    33   2.2     
sp:HBPA_CASGL Hemoglobin A.                                            33   2.2     
gp:AE003824_30 [AE003824] gi:21627428  CG8290-PC [Drosophila mel...    33   2.9     
pir:H72706 hypothetical protein APE1071 - Aeropyrum pernix (stra...    33   2.9     
gp:AF163841_9 [AF163841] gi:9478260  putative serine/threonine p...    33   2.9     
prf:763614A      hemoglobin gamma - Ovis orientalis aries (domes...    33   2.9     
gp:AF090111_1 [AF090111] gi:4138837  phospholipase C-gamma-1a [X...    33   2.9     
gpu:BC070837_1 [BC070837] gi:47123193  LOC398360 protein [Xenopu...    33   2.9     
pir:GGNKT globin beta chain - ark shell (Anadara trapezia)>prf:1...    33   2.9     
gp:STU011891_1 [AJ011891] gi:4584515  starch branching enzyme II...    33   2.9     
pir:I77330 hemoglobin gamma chain - tarsier>gp:TARHBG_1 [M33971]...    33   3.7     
spu:HBA3_RANCA Hemoglobin alpha-III chain, larval.>sp:HBA3_RANCA...    33   3.7     
gpu:CR382135_743 [CR382135] gi:49654095  Debaryomyces hansenii c...    33   3.7     
sp:HBL4_ORYSA Non-symbiotic hemoglobin 4 (rHb4) (ORYsa GLB1d).>g...    33   3.7     
sp:HBG_TARSY Hemoglobin gamma chain.                                   33   3.7     
spu:HBB_LATCH Hemoglobin beta chain.>sp:HBB_LATCH Hemoglobin bet...    33   3.7     
gpu:AB095363_1 [AB095363] gi:30314562  dissimilatory sulfite red...    33   3.7     
gpu:CR382122_643 [CR382122] gi:49641307  Kluyveromyces lactis st...    32   4.9     
pir:S61521 hemoglobin beta chain - blood clam (Barbatia lima)>gp...    32   4.9     
gp:TOHEMOGLB_1 [Z99635] gi:3393069  hemoglobin [Trema orientalis]      32   4.9     
spu:CAP2_HUMAN Adenylyl cyclase-associated protein 2 (CAP 2).>sp...    32   4.9     
pir:S06705 hypothetical HTLV-1 related endogenous sequence HRES1...    32   4.9     
spu:PUR2_HELPJ Phosphoribosylamine--glycine ligase (EC 6.3.4.13)...    32   6.4     
gp:AF016988_1 [AF016988] gi:11320867  gamma1-globin [Chiropotes ...    32   6.4     
gp:AE014344_12 [AE014344] gi:23347117  lipoprotein, putative [Br...    32   6.4     
pir:A35363 synapsin I splice form a - human>prf:1609164A      sy...    32   6.4     
spu:SYN1_HUMAN Synapsin I (Brain protein 4.1).>sp:SYN1_HUMAN Syn...    32   6.4     
gp:AF443292_9 [AF443292] gi:22901254  putative major capsid prot...    32   6.4     
gp:STU011888_1 [AJ011888] gi:4584509  starch branching enzyme II...    32   6.4     
pir:AD3451 hypothetical protein BMEI1594 [imported] - Brucella m...    32   6.4     
pir:HEDKM hemoglobin epsilon chain - muscovy duck>prf:1612374A  ...    32   6.4     
sp:HBE_CAIMO Hemoglobin epsilon chain.                                 32   6.4     
gp:HUMSYN1E13_2 [M58378] gi:553653  synapsin Ib [Homo sapiens]         32   6.4     
spu:GLBB_ANATR Globin I beta chain.>sp:GLBB_ANATR Globin I beta ...    32   6.4     
prf:2110357A      beta globin - Anadara trapezia>gp:AAABGLOB_1 [...    32   6.4     
gpu:AP006575_72 [AP006575] gi:35212598  cation efflux system pro...    32   8.3     
gp:AF062655_1 [AF062655] gi:3153821  plenty-of-prolines-101 [Mus...    32   8.3     
gpu:BC048879_1 [BC048879] gi:29124615  zgc:55623 [Danio rerio]         32   8.3     
gpu:AP005341_105 [AP005341] gi:37199749  4-diphosphocytidyl-2-me...    32   8.3     
gp:AP005217_220 [AP005217] gi:23492942  conserved hypothetical p...    32   8.3     
gp:AE015937_162 [AE015937] gi:28202675  phage infection protein ...    32   8.3     


>prf:2312242A      hemoglobin - Daphnia magna>prf:2512352A    
           hemoglobin - Daphnia magna>gp:AB021134_2 [AB021134]
           gi:4589707  hemoglobin [Daphnia magna]>gp:DMU67067_1
           [U67067] gi:2105139  hemoglobin [Daphnia magna]
          Length = 348

 Score =  336 bits (861), Expect = 2e-91
 Identities = 169/192 (88%), Positives = 176/192 (91%)
 Frame = +1

Query: 1   GVVAFVSACSQAPGXXXXXXXXXXXXXSADDASEASILSSHERSLIRKTWDQAKKDGDVA 180
           GV+AFV+ACSQAPG             SADD SEA +LS+HERSLIRKTWDQAKKDGDVA
Sbjct: 11  GVIAFVNACSQAPGTTTTTVTTTVTTVSADDGSEAGLLSAHERSLIRKTWDQAKKDGDVA 70

Query: 181 PQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQAYTILAGLNVVIQSLSSQELMA 360
           PQVLFRFVKAHPEYQKMFSKFANVPQ+ELLSNGNFLAQAYTILAGLNVVIQSL SQELMA
Sbjct: 71  PQVLFRFVKAHPEYQKMFSKFANVPQSELLSNGNFLAQAYTILAGLNVVIQSLFSQELMA 130

Query: 361 NQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELGSGFTAEARQAWKNGLAALVAGISK 540
           NQLNALGGAH+PRGATPVMFEQFGGILEEVLAEELGSGFTAEARQAWKNGLAALVAGI+K
Sbjct: 131 NQLNALGGAHQPRGATPVMFEQFGGILEEVLAEELGSGFTAEARQAWKNGLAALVAGIAK 190

Query: 541 NLKKAEDLADPQ 576
           NLKKAEDLADPQ
Sbjct: 191 NLKKAEDLADPQ 202



 Score = 63.5 bits (153), Expect = 2e-09
 Identities = 39/151 (25%), Positives = 70/151 (45%), Gaps = 1/151 (0%)
 Frame = +1

Query: 88  DDASEASILSSHERSLIRKTWDQAKKDGDVAPQVLF-RFVKAHPEYQKMFSKFANVPQAE 264
           D A   + L+ H+   ++++W+  + D +     +F +  K  P  QK F+KFANV    
Sbjct: 197 DLADPQTKLTPHQIRDVQRSWENIRNDRNALVSSIFVKLFKETPRIQKFFAKFANVAVDS 256

Query: 265 LLSNGNFLAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILE 444
           L  N  +  Q   +   L+ +I ++  +  +   +N +   H  RG     +E F  +L 
Sbjct: 257 LAGNAEYEKQIALVADRLDTMISAMDDKLQLLGNINYMRYTHTERGIPRAPWEDFSRLLL 316

Query: 445 EVLAEELGSGFTAEARQAWKNGLAALVAGIS 537
           +VL  +   G + +   +WK  LA  V G+S
Sbjct: 317 DVLGSK---GVSTDDLDSWKGVLAVFVNGVS 344



>prf:2512352C      hemoglobin - Daphnia magna>gp:AB021134_1
           [AB021134] gi:4589706  hemoglobin [Daphnia
           magna]>gp:AB021137_1 [AB021137] gi:4589712  hemoglobin
           [Daphnia magna]
          Length = 348

 Score =  330 bits (846), Expect = 9e-90
 Identities = 166/192 (86%), Positives = 174/192 (90%)
 Frame = +1

Query: 1   GVVAFVSACSQAPGXXXXXXXXXXXXXSADDASEASILSSHERSLIRKTWDQAKKDGDVA 180
           GVVAFVSA SQAPG             SADD SEA ILS+HERSLIRKTW+QA+KDGDVA
Sbjct: 11  GVVAFVSAYSQAPGTTTTTVTTTVTTVSADDGSEAGILSAHERSLIRKTWEQARKDGDVA 70

Query: 181 PQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQAYTILAGLNVVIQSLSSQELMA 360
           PQ+LFRFVKAHPEYQKMFSKFANVPQAELL+NGNFLAQAYTILAGLNVV+QSLSSQELMA
Sbjct: 71  PQILFRFVKAHPEYQKMFSKFANVPQAELLTNGNFLAQAYTILAGLNVVVQSLSSQELMA 130

Query: 361 NQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELGSGFTAEARQAWKNGLAALVAGISK 540
           NQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELGS FTAEARQAWKNGL AL++GISK
Sbjct: 131 NQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELGSSFTAEARQAWKNGLTALISGISK 190

Query: 541 NLKKAEDLADPQ 576
           NLKKAEDLADPQ
Sbjct: 191 NLKKAEDLADPQ 202



 Score = 62.4 bits (150), Expect = 4e-09
 Identities = 39/151 (25%), Positives = 71/151 (46%), Gaps = 1/151 (0%)
 Frame = +1

Query: 88  DDASEASILSSHERSLIRKTWDQAKKDGDVAPQVLF-RFVKAHPEYQKMFSKFANVPQAE 264
           D A   + L+ H+   ++++W+  +   +     +F +  K  P  QK F+KFANV    
Sbjct: 197 DLADPQTKLTPHQIQDVQRSWENIRNGRNALVSSIFVKLFKETPRIQKFFAKFANVAVDS 256

Query: 265 LLSNGNFLAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILE 444
           L  N  +  Q   +   L+ +I ++  +  +   +N +   H  RG     +E FG +L 
Sbjct: 257 LAGNAEYEKQVALVADRLDTMISAMDDKLQLLGNINYMRYTHTERGIPRGPWEDFGRLLL 316

Query: 445 EVLAEELGSGFTAEARQAWKNGLAALVAGIS 537
           + LA    +G +++   +WK  LA  V G+S
Sbjct: 317 DSLA---ANGVSSDDLDSWKGVLAVFVNGVS 344



>gp:AF441753_1 [AF441753] gi:20513976  2-domain hemoglobin protein
           subunit [Daphnia spinulata]
          Length = 263

 Score =  291 bits (746), Expect = 3e-78
 Identities = 146/156 (93%), Positives = 152/156 (96%)
 Frame = +1

Query: 109 ILSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFL 288
           ILSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQ+ELL NGNFL
Sbjct: 1   ILSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQSELLGNGNFL 60

Query: 289 AQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELG 468
           AQAYTILAGLNVVIQSL SQELMANQLNALGGAH+ RGATP+MFEQFGGIL+EVLAEELG
Sbjct: 61  AQAYTILAGLNVVIQSLFSQELMANQLNALGGAHQARGATPIMFEQFGGILZEVLAEELG 120

Query: 469 SGFTAEARQAWKNGLAALVAGISKNLKKAEDLADPQ 576
           S FTAEARQAWKNGLAALVAGI+KNLKK+EDLADPQ
Sbjct: 121 SAFTAEARQAWKNGLAALVAGIAKNLKKSEDLADPQ 156



 Score = 44.7 bits (104), Expect = 0.001
 Identities = 25/108 (23%), Positives = 49/108 (45%), Gaps = 1/108 (0%)
 Frame = +1

Query: 82  SADDASEASILSSHERSLIRKTWDQAKKDGDVAPQVLF-RFVKAHPEYQKMFSKFANVPQ 258
           S D A   + L+ H+   ++++W+  +   +     +F +  K  P  QK F+KF NV  
Sbjct: 149 SEDLADPQTKLTPHQIRDVQRSWENIRNGRNALVSSIFVKLFKETPRIQKFFAKFGNVAV 208

Query: 259 AELLSNGNFLAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRG 402
             L  N ++  Q   +   L+ +I ++  +  +   +N +   H  RG
Sbjct: 209 DSLAGNADYEKQVALVADRLDTIISAMDDKLQLLGNINYMRYTHTERG 256



>gp:AF441751_1 [AF441751] gi:20513972  2-domain hemoglobin protein
           subunit [Daphnia spinulata]
          Length = 272

 Score =  291 bits (746), Expect = 3e-78
 Identities = 146/156 (93%), Positives = 152/156 (96%)
 Frame = +1

Query: 109 ILSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFL 288
           ILSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQ+ELL NGNFL
Sbjct: 1   ILSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQSELLGNGNFL 60

Query: 289 AQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELG 468
           AQAYTILAGLNVVIQSL SQELMANQLNALGGAH+ RGATP+MFEQFGGIL+EVLAEELG
Sbjct: 61  AQAYTILAGLNVVIQSLFSQELMANQLNALGGAHQARGATPIMFEQFGGILZEVLAEELG 120

Query: 469 SGFTAEARQAWKNGLAALVAGISKNLKKAEDLADPQ 576
           S FTAEARQAWKNGLAALVAGI+KNLKK+EDLADPQ
Sbjct: 121 SAFTAEARQAWKNGLAALVAGIAKNLKKSEDLADPQ 156



 Score = 48.9 bits (115), Expect = 5e-05
 Identities = 29/124 (23%), Positives = 56/124 (44%), Gaps = 1/124 (0%)
 Frame = +1

Query: 82  SADDASEASILSSHERSLIRKTWDQAKKDGDVAPQVLF-RFVKAHPEYQKMFSKFANVPQ 258
           S D A   + L+ H+   ++++W+  +   +     +F +  K  P  QK F+KF NV  
Sbjct: 149 SEDLADPQTKLTPHQIQDVQRSWENIRNGRNALVSSIFVKLFKETPRIQKFFAKFGNVAV 208

Query: 259 AELLSNGNFLAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGI 438
             L  N ++  Q   +   L+ +I ++  +  +   +N +   H  RG     +E F  +
Sbjct: 209 DSLAGNADYEKQVALVADRLDTIISAMDDKLQLLGNINYMRYTHTERGIPRGPWEDFSRL 268

Query: 439 LEEV 450
           L +V
Sbjct: 269 LLDV 272



>gp:AF441748_1 [AF441748] gi:20513966  2-domain hemoglobin protein
           subunit [Daphnia spinulata]>gp:AF441750_1 [AF441750]
           gi:20513970  2-domain hemoglobin protein subunit
           [Daphnia spinulata]
          Length = 272

 Score =  291 bits (746), Expect = 3e-78
 Identities = 146/156 (93%), Positives = 152/156 (96%)
 Frame = +1

Query: 109 ILSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFL 288
           ILSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQ+ELL NGNFL
Sbjct: 1   ILSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQSELLGNGNFL 60

Query: 289 AQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELG 468
           AQAYTILAGLNVVIQSL SQELMANQLNALGGAH+ RGATP+MFEQFGGIL+EVLAEELG
Sbjct: 61  AQAYTILAGLNVVIQSLFSQELMANQLNALGGAHQARGATPIMFEQFGGILZEVLAEELG 120

Query: 469 SGFTAEARQAWKNGLAALVAGISKNLKKAEDLADPQ 576
           S FTAEARQAWKNGLAALVAGI+KNLKK+EDLADPQ
Sbjct: 121 SAFTAEARQAWKNGLAALVAGIAKNLKKSEDLADPQ 156



 Score = 48.5 bits (114), Expect = 7e-05
 Identities = 29/124 (23%), Positives = 56/124 (44%), Gaps = 1/124 (0%)
 Frame = +1

Query: 82  SADDASEASILSSHERSLIRKTWDQAKKDGDVAPQVLF-RFVKAHPEYQKMFSKFANVPQ 258
           S D A   + L+ H+   ++++W+  +   +     +F +  K  P  QK F+KF NV  
Sbjct: 149 SEDLADPQTKLTPHQIRDVQRSWENIRNGRNALVSSIFVKLFKETPRIQKFFAKFGNVAV 208

Query: 259 AELLSNGNFLAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGI 438
             L  N ++  Q   +   L+ +I ++  +  +   +N +   H  RG     +E F  +
Sbjct: 209 DSLAGNADYEKQVALVADRLDTIISAMDDKLQLLGNINYMRYTHTERGIPRGPWEDFSRL 268

Query: 439 LEEV 450
           L +V
Sbjct: 269 LLDV 272



>gp:AF441742_1 [AF441742] gi:20513954  2-domain hemoglobin protein
           subunit [Daphnia spinulata]
          Length = 272

 Score =  291 bits (745), Expect = 4e-78
 Identities = 147/156 (94%), Positives = 152/156 (97%)
 Frame = +1

Query: 109 ILSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFL 288
           ILSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQ+ELL NGNFL
Sbjct: 1   ILSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQSELLGNGNFL 60

Query: 289 AQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELG 468
           AQAYTILAGLNVVIQSL SQELMANQLNALGGAH+ RGATP+MFEQFGGILEEVLAEELG
Sbjct: 61  AQAYTILAGLNVVIQSLFSQELMANQLNALGGAHQARGATPIMFEQFGGILEEVLAEELG 120

Query: 469 SGFTAEARQAWKNGLAALVAGISKNLKKAEDLADPQ 576
           S FTAEARQAWKNGLAALVAGI+KNLKK+EDLADPQ
Sbjct: 121 STFTAEARQAWKNGLAALVAGIAKNLKKSEDLADPQ 156



 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 29/124 (23%), Positives = 56/124 (44%), Gaps = 1/124 (0%)
 Frame = +1

Query: 82  SADDASEASILSSHERSLIRKTWDQAKKDGDVAPQVLF-RFVKAHPEYQKMFSKFANVPQ 258
           S D A   + L+ H+   ++++W+  +   +     +F +  K  P  QK F+KF NV  
Sbjct: 149 SEDLADPQTKLTPHQIRDVQRSWENIRNGRNALVSSIFVKLFKETPRIQKFFAKFGNVAV 208

Query: 259 AELLSNGNFLAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGI 438
             L  N ++  Q   +   L+ +I ++  +  +   +N +   H  RG     +E F  +
Sbjct: 209 DSLAGNVDYEKQVALVADRLDTIISAMDDKLQLLGNINYMRYTHTERGIPRGPWEDFSRL 268

Query: 439 LEEV 450
           L +V
Sbjct: 269 LLDV 272



>gp:AF441740_1 [AF441740] gi:20513950  2-domain hemoglobin protein
           subunit [Daphnia spinulata]
          Length = 272

 Score =  291 bits (745), Expect = 4e-78
 Identities = 147/156 (94%), Positives = 152/156 (97%)
 Frame = +1

Query: 109 ILSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFL 288
           ILSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQ+ELL NGNFL
Sbjct: 1   ILSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQSELLGNGNFL 60

Query: 289 AQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELG 468
           AQAYTILAGLNVVIQSL SQELMANQLNALGGAH+ RGATP+MFEQFGGILEEVLAEELG
Sbjct: 61  AQAYTILAGLNVVIQSLFSQELMANQLNALGGAHQARGATPIMFEQFGGILEEVLAEELG 120

Query: 469 SGFTAEARQAWKNGLAALVAGISKNLKKAEDLADPQ 576
           S FTAEARQAWKNGLAALVAGI+KNLKK+EDLADPQ
Sbjct: 121 STFTAEARQAWKNGLAALVAGIAKNLKKSEDLADPQ 156



 Score = 48.5 bits (114), Expect = 7e-05
 Identities = 29/124 (23%), Positives = 56/124 (44%), Gaps = 1/124 (0%)
 Frame = +1

Query: 82  SADDASEASILSSHERSLIRKTWDQAKKDGDVAPQVLF-RFVKAHPEYQKMFSKFANVPQ 258
           S D A   + L+ H+   ++++W+  +   +     +F +  K  P  QK F+KF NV  
Sbjct: 149 SEDLADPQTKLTPHQIRDVQRSWENIRNGRNALVSSIFVKLFKETPRIQKFFAKFGNVAV 208

Query: 259 AELLSNGNFLAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGI 438
             L  N ++  Q   +   L+ +I ++  +  +   +N +   H  RG     +E F  +
Sbjct: 209 DSLAGNADYEKQVALVADRLDTIISAMDDKLQLLGNINYMRYTHTERGIPRGPWEDFSRL 268

Query: 439 LEEV 450
           L +V
Sbjct: 269 LLDV 272



>gp:AF441747_1 [AF441747] gi:20513964  2-domain hemoglobin protein
           subunit [Daphnia spinulata]
          Length = 271

 Score =  291 bits (745), Expect = 4e-78
 Identities = 147/156 (94%), Positives = 152/156 (97%)
 Frame = +1

Query: 109 ILSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFL 288
           ILSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQ+ELL NGNFL
Sbjct: 1   ILSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQSELLGNGNFL 60

Query: 289 AQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELG 468
           AQAYTILAGLNVVIQSL SQELMANQLNALGGAH+ RGATP+MFEQFGGILEEVLAEELG
Sbjct: 61  AQAYTILAGLNVVIQSLFSQELMANQLNALGGAHQARGATPIMFEQFGGILEEVLAEELG 120

Query: 469 SGFTAEARQAWKNGLAALVAGISKNLKKAEDLADPQ 576
           S FTAEARQAWKNGLAALVAGI+KNLKK+EDLADPQ
Sbjct: 121 STFTAEARQAWKNGLAALVAGIAKNLKKSEDLADPQ 156



 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 28/121 (23%), Positives = 54/121 (44%), Gaps = 1/121 (0%)
 Frame = +1

Query: 82  SADDASEASILSSHERSLIRKTWDQAKKDGDVAPQVLF-RFVKAHPEYQKMFSKFANVPQ 258
           S D A   + L+ H+   ++++W+  +   +     +F +  K  P  QK F+KF NV  
Sbjct: 149 SEDLADPQTKLTPHQIRDVQRSWENIRNGRNALVSSIFVKLFKETPRIQKFFAKFGNVAV 208

Query: 259 AELLSNGNFLAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGI 438
             L  N ++  Q   +   L+ +I ++  +  +   +N +   H  RG     +E F  +
Sbjct: 209 DSLAGNADYEKQVALVADRLDTIISAMDDKLQLLGNINYMRYTHTERGIPRGPWEDFSRL 268

Query: 439 L 441
           L
Sbjct: 269 L 269



>gp:AF441756_1 [AF441756] gi:20513982  2-domain hemoglobin protein
           subunit [Daphnia exilis]
          Length = 272

 Score =  290 bits (742), Expect = 1e-77
 Identities = 146/156 (93%), Positives = 152/156 (96%)
 Frame = +1

Query: 109 ILSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFL 288
           ILSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQ+ELL +GNFL
Sbjct: 1   ILSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQSELLGDGNFL 60

Query: 289 AQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELG 468
           AQAYTILAGLNVVIQSL SQELMANQLNALGGAH+ RGATP+MFEQFGGILEEVLAEELG
Sbjct: 61  AQAYTILAGLNVVIQSLFSQELMANQLNALGGAHQARGATPIMFEQFGGILEEVLAEELG 120

Query: 469 SGFTAEARQAWKNGLAALVAGISKNLKKAEDLADPQ 576
           S FTAEARQAWKNGLAALVAGI+KNLKK+EDLADPQ
Sbjct: 121 SAFTAEARQAWKNGLAALVAGIAKNLKKSEDLADPQ 156



 Score = 48.5 bits (114), Expect = 7e-05
 Identities = 29/124 (23%), Positives = 56/124 (44%), Gaps = 1/124 (0%)
 Frame = +1

Query: 82  SADDASEASILSSHERSLIRKTWDQAKKDGDVAPQVLF-RFVKAHPEYQKMFSKFANVPQ 258
           S D A   + L+ H+   ++++W+  +   +     +F +  K  P  QK F+KF NV  
Sbjct: 149 SEDLADPQTKLTPHQIRDVQRSWENIRNGRNALVSSIFVKLFKETPRIQKFFAKFGNVAV 208

Query: 259 AELLSNGNFLAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGI 438
             L  N ++  Q   +   L+ +I ++  +  +   +N +   H  RG     +E F  +
Sbjct: 209 DSLAGNADYEKQVALVADRLDTIISAMDDKLQLLGNINYMRYTHTERGIPRGPWEDFSRL 268

Query: 439 LEEV 450
           L +V
Sbjct: 269 LLDV 272



>gp:AF441754_1 [AF441754] gi:20513978  2-domain hemoglobin protein
           subunit [Daphnia spinulata]
          Length = 272

 Score =  290 bits (742), Expect = 1e-77
 Identities = 145/156 (92%), Positives = 151/156 (95%)
 Frame = +1

Query: 109 ILSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFL 288
           ILSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQ+ELL NGNFL
Sbjct: 1   ILSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQSELLGNGNFL 60

Query: 289 AQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELG 468
           AQAYTILAGLNVVIQSL SQELMANQLNALGGAH+ RGATP+MFEQFGGIL+EVLAEELG
Sbjct: 61  AQAYTILAGLNVVIQSLFSQELMANQLNALGGAHQARGATPIMFEQFGGILZEVLAEELG 120

Query: 469 SGFTAEARQAWKNGLAALVAGISKNLKKAEDLADPQ 576
           S FTAEARQAWKNGLAALVAGI+KNLKK+EDL DPQ
Sbjct: 121 SAFTAEARQAWKNGLAALVAGIAKNLKKSEDLXDPQ 156



 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 28/124 (22%), Positives = 55/124 (43%), Gaps = 1/124 (0%)
 Frame = +1

Query: 82  SADDASEASILSSHERSLIRKTWDQAKKDGDVAPQVLF-RFVKAHPEYQKMFSKFANVPQ 258
           S D     + L+ H+   ++++W+  +   +     +F +  K  P  QK F+KF NV  
Sbjct: 149 SEDLXDPQTKLTPHQIXDVQRSWENIRNGRNALVSSIFVKLFKETPRIQKFFAKFGNVAV 208

Query: 259 AELLSNGNFLAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGI 438
             L  N ++  Q   +   L+ +I ++  +  +   +N +   H  RG     +E F  +
Sbjct: 209 DSLAGNADYEKQVALVADRLDTIISAMDDKLQLLGNINYMRYTHTERGIPRGPWEDFSRL 268

Query: 439 LEEV 450
           L +V
Sbjct: 269 LLDV 272



>gp:AF441749_1 [AF441749] gi:20513968  2-domain hemoglobin protein
           subunit [Daphnia spinulata]
          Length = 272

 Score =  290 bits (742), Expect = 1e-77
 Identities = 145/156 (92%), Positives = 151/156 (95%)
 Frame = +1

Query: 109 ILSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFL 288
           ILSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQ+ELL NGNFL
Sbjct: 1   ILSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQSELLGNGNFL 60

Query: 289 AQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELG 468
           AQAYTILAGLNVVIQSL SQELMANQLNALGGAH+ RGATP+MFEQFGGIL+EVLAEELG
Sbjct: 61  AQAYTILAGLNVVIQSLFSQELMANQLNALGGAHQARGATPIMFEQFGGILZEVLAEELG 120

Query: 469 SGFTAEARQAWKNGLAALVAGISKNLKKAEDLADPQ 576
           S FTAEARQAWKNGLAALVAGI+KNLKK+EDL DPQ
Sbjct: 121 SAFTAEARQAWKNGLAALVAGIAKNLKKSEDLGDPQ 156



 Score = 47.0 bits (110), Expect = 2e-04
 Identities = 28/124 (22%), Positives = 55/124 (43%), Gaps = 1/124 (0%)
 Frame = +1

Query: 82  SADDASEASILSSHERSLIRKTWDQAKKDGDVAPQVLF-RFVKAHPEYQKMFSKFANVPQ 258
           S D     + L+ H+   ++++W+  +   +     +F +  K  P  QK F+KF NV  
Sbjct: 149 SEDLGDPQTKLTPHQIRDVQRSWENIRNGRNALVSSIFVKLFKETPRIQKFFAKFGNVAV 208

Query: 259 AELLSNGNFLAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGI 438
             L  N ++  Q   +   L+ +I ++  +  +   +N +   H  RG     +E F  +
Sbjct: 209 DSLAGNADYEKQVALVADRLDTIISAMDDKLQLLGNINYMRYTHTERGIPRGPWEDFSRL 268

Query: 439 LEEV 450
           L +V
Sbjct: 269 LLDV 272



>gp:AF441743_1 [AF441743] gi:20513956  2-domain hemoglobin protein
           subunit [Daphnia spinulata]
          Length = 272

 Score =  289 bits (739), Expect = 2e-77
 Identities = 146/156 (93%), Positives = 152/156 (96%)
 Frame = +1

Query: 109 ILSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFL 288
           ILSS+ERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQ+ELL NGNFL
Sbjct: 1   ILSSYERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQSELLGNGNFL 60

Query: 289 AQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELG 468
           AQAYTILAGLNVVIQSL SQELMANQLNALGGAH+ RGATP+MFEQFGGILEEVLAEELG
Sbjct: 61  AQAYTILAGLNVVIQSLFSQELMANQLNALGGAHQARGATPIMFEQFGGILEEVLAEELG 120

Query: 469 SGFTAEARQAWKNGLAALVAGISKNLKKAEDLADPQ 576
           S FTAEARQAWKNGLAALVAGI+KNLKK+EDLADPQ
Sbjct: 121 STFTAEARQAWKNGLAALVAGIAKNLKKSEDLADPQ 156



 Score = 45.1 bits (105), Expect = 7e-04
 Identities = 28/124 (22%), Positives = 52/124 (41%), Gaps = 1/124 (0%)
 Frame = +1

Query: 82  SADDASEASILSSHERSLIRKTWDQAKKDGDVAPQVLF-RFVKAHPEYQKMFSKFANVPQ 258
           S D A     L+ H+   ++++W+  +   +     +F +  K  P  QK F+KF NV  
Sbjct: 149 SEDLADPQXKLTPHQIRDVQRSWENIRNGRNALVSSIFVKLFKETPRIQKFFAKFGNVAV 208

Query: 259 AELLSNGNFLAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGI 438
             L  N ++  Q   +   L  +   +  +  +   +N +   H  RG     +E F  +
Sbjct: 209 DSLAGNADYEKQVALVADRLXTIXSGMDDKLQLLGNINYMRYTHTERGIPRGPWEDFSRL 268

Query: 439 LEEV 450
           L +V
Sbjct: 269 LLDV 272



>gp:AF441755_1 [AF441755] gi:20513980  2-domain hemoglobin protein
           subunit [Daphnia exilis]
          Length = 263

 Score =  288 bits (738), Expect = 3e-77
 Identities = 146/156 (93%), Positives = 151/156 (96%)
 Frame = +1

Query: 109 ILSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFL 288
           ILSSHERSLIRKTWDQAKKDGDVAPQVL RFVKAHPEYQKMFSKFANVPQ+ELL NGNFL
Sbjct: 1   ILSSHERSLIRKTWDQAKKDGDVAPQVLXRFVKAHPEYQKMFSKFANVPQSELLGNGNFL 60

Query: 289 AQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELG 468
           AQAYTILAGLNVVIQSL SQELMANQLNALGGAH+ RGATP+MFEQFGGILEEVLAEELG
Sbjct: 61  AQAYTILAGLNVVIQSLFSQELMANQLNALGGAHQARGATPIMFEQFGGILEEVLAEELG 120

Query: 469 SGFTAEARQAWKNGLAALVAGISKNLKKAEDLADPQ 576
           S FTAEARQAWKNGLAALVAGI+KNLKK+EDLADPQ
Sbjct: 121 STFTAEARQAWKNGLAALVAGIAKNLKKSEDLADPQ 156



 Score = 42.4 bits (98), Expect = 0.005
 Identities = 24/108 (22%), Positives = 48/108 (44%), Gaps = 1/108 (0%)
 Frame = +1

Query: 82  SADDASEASILSSHERSLIRKTWDQAKKDGDVAPQVLF-RFVKAHPEYQKMFSKFANVPQ 258
           S D A   + L+ H+   ++++W+  +   +     +F +  K  P  QK F+KF NV  
Sbjct: 149 SEDLADPQTKLTPHQIRDVQRSWENIRNGRNALVSSIFVKLFKETPRIQKFFAKFGNVAV 208

Query: 259 AELLSNGNFLAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRG 402
             L  N ++  Q   +   L+ +I ++  +  +   +  +   H  RG
Sbjct: 209 DSLAGNADYEKQVALVADRLDTIISAMDDKLQLLGNIGYMRYTHTERG 256



>gp:AF441752_1 [AF441752] gi:20513974  2-domain hemoglobin protein
           subunit [Daphnia spinulata]
          Length = 270

 Score =  288 bits (738), Expect = 3e-77
 Identities = 144/154 (93%), Positives = 150/154 (96%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQ 294
           SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQ+ELL NGNFLAQ
Sbjct: 1   SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQSELLGNGNFLAQ 60

Query: 295 AYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELGSG 474
           AYTILAGLNVVIQSL SQELMANQLNALGGAH+ RGATP+MFEQFGGIL+EVLAEELGS 
Sbjct: 61  AYTILAGLNVVIQSLFSQELMANQLNALGGAHQARGATPIMFEQFGGILZEVLAEELGSA 120

Query: 475 FTAEARQAWKNGLAALVAGISKNLKKAEDLADPQ 576
           FTAEARQAWKNGLAALVAGI+KNLKK+EDLADPQ
Sbjct: 121 FTAEARQAWKNGLAALVAGIAKNLKKSEDLADPQ 154



 Score = 48.5 bits (114), Expect = 7e-05
 Identities = 29/124 (23%), Positives = 56/124 (44%), Gaps = 1/124 (0%)
 Frame = +1

Query: 82  SADDASEASILSSHERSLIRKTWDQAKKDGDVAPQVLF-RFVKAHPEYQKMFSKFANVPQ 258
           S D A   + L+ H+   ++++W+  +   +     +F +  K  P  QK F+KF NV  
Sbjct: 147 SEDLADPQTKLTPHQIRDVQRSWENIRNGRNALVSSIFVKLFKETPRIQKFFAKFGNVAV 206

Query: 259 AELLSNGNFLAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGI 438
             L  N ++  Q   +   L+ +I ++  +  +   +N +   H  RG     +E F  +
Sbjct: 207 DSLAGNADYEKQVALVADRLDTIISAMDDKLQLLGNINYMRYTHTERGIPRGPWEDFSRL 266

Query: 439 LEEV 450
           L +V
Sbjct: 267 LLDV 270



>gp:AF074722_1 [AF074722] gi:5881967  di-domain hemoglobin precursor
           [Daphnia pulex]
          Length = 351

 Score =  288 bits (737), Expect = 4e-77
 Identities = 141/186 (75%), Positives = 158/186 (84%)
 Frame = +1

Query: 19  SACSQAPGXXXXXXXXXXXXXSADDASEASILSSHERSLIRKTWDQAKKDGDVAPQVLFR 198
           S+CSQAPG             +AD+ S++ +LSSH+RS+IRKTWDQAKKDGDV P++LFR
Sbjct: 20  SSCSQAPGTTITSVTTTVTTVTADEDSDSGLLSSHDRSIIRKTWDQAKKDGDVPPKILFR 79

Query: 199 FVKAHPEYQKMFSKFANVPQAELLSNGNFLAQAYTILAGLNVVIQSLSSQELMANQLNAL 378
           F+ A+PEYQKMF  FA VPQ ELL NGNFLAQAYTILAGLNVVIQSLSSQEL+ANQ+NAL
Sbjct: 80  FIVANPEYQKMFKSFATVPQNELLGNGNFLAQAYTILAGLNVVIQSLSSQELLANQINAL 139

Query: 379 GGAHKPRGATPVMFEQFGGILEEVLAEELGSGFTAEARQAWKNGLAALVAGISKNLKKAE 558
           GGAH+PRGATP+MFEQFG I EEVLAEELG  F AEARQAWKNG+ ALVAGISKNLKKAE
Sbjct: 140 GGAHQPRGATPIMFEQFGAITEEVLAEELGIAFNAEARQAWKNGMRALVAGISKNLKKAE 199

Query: 559 DLADPQ 576
           DLADPQ
Sbjct: 200 DLADPQ 205



 Score = 58.5 bits (140), Expect = 6e-08
 Identities = 39/152 (25%), Positives = 71/152 (46%), Gaps = 2/152 (1%)
 Frame = +1

Query: 88  DDASEASILSSHERSLIRKTWDQAKKDGDVAPQVLF-RFVKAHPEYQKMFSKFANVPQAE 264
           D A   + L+ H+   ++++W+  + + +     +F +  K  P  QK F+KFANV    
Sbjct: 200 DLADPQTKLTPHQIHDVQRSWENIRANRNSLVSAIFVKLFKETPRVQKHFAKFANVAVDS 259

Query: 265 LLSNGNFLAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATP-VMFEQFGGIL 441
           L  N ++  Q   +   L+ +I ++  +  +   +N +   H+P  A P   FE F  +L
Sbjct: 260 LPGNADYEKQVALVADRLDTIISAMDDKLQLLGNINYMRYTHQPPRAIPRQTFEDFARLL 319

Query: 442 EEVLAEELGSGFTAEARQAWKNGLAALVAGIS 537
            + L     SG + +   +WK  L   V G+S
Sbjct: 320 IDGLT---ASGVSGDDMDSWKGVLTIFVNGVS 348



>gp:AF441744_1 [AF441744] gi:20513958  2-domain hemoglobin protein
           subunit [Daphnia spinulata]
          Length = 269

 Score =  285 bits (729), Expect = 3e-76
 Identities = 143/153 (93%), Positives = 148/153 (96%)
 Frame = +1

Query: 118 SHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQA 297
           SHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQ+ELL NGNFLAQA
Sbjct: 1   SHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQSELLGNGNFLAQA 60

Query: 298 YTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELGSGF 477
           YTILAGLNVVIQSL SQELMANQLNALGGAH+ RGATP+MFEQFGGILEEVLAEELGS F
Sbjct: 61  YTILAGLNVVIQSLFSQELMANQLNALGGAHQARGATPIMFEQFGGILEEVLAEELGSTF 120

Query: 478 TAEARQAWKNGLAALVAGISKNLKKAEDLADPQ 576
           TAEARQAWKNGLAALVAGI+KNLKK+EDL DPQ
Sbjct: 121 TAEARQAWKNGLAALVAGIAKNLKKSEDLGDPQ 153



 Score = 44.7 bits (104), Expect = 0.001
 Identities = 25/114 (21%), Positives = 50/114 (42%), Gaps = 1/114 (0%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQAKKDGDVAPQVLF-RFVKAHPEYQKMFSKFANVPQAELLSNGNFL 288
           L+ H+   ++++W+  +   +     +F +  K  P  QK F+KF NV    L  N ++ 
Sbjct: 156 LTPHQIXDVQRSWENIRNGRNALVSSIFVKLFKETPRIQKFFAKFGNVAVDSLAGNADYE 215

Query: 289 AQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEV 450
            Q   +   L  +  ++  +  +   +N +   H  RG     +E F  +L +V
Sbjct: 216 KQVALVADXLXTIXSAMXDKLQLLGNINYMRYTHTERGIPRGPWEDFSRLLLDV 269



>gp:AF441746_1 [AF441746] gi:20513962  2-domain hemoglobin protein
           subunit [Daphnia spinulata]
          Length = 263

 Score =  285 bits (729), Expect = 3e-76
 Identities = 144/156 (92%), Positives = 149/156 (95%)
 Frame = +1

Query: 109 ILSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFL 288
           I SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQ+ELL NGNFL
Sbjct: 1   IXSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQSELLGNGNFL 60

Query: 289 AQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELG 468
           AQAYTILAGLNVVIQSL SQELMANQLNALGGAH+ RGATP+MFEQFGGILEEVLAEELG
Sbjct: 61  AQAYTILAGLNVVIQSLFSQELMANQLNALGGAHQARGATPIMFEQFGGILEEVLAEELG 120

Query: 469 SGFTAEARQAWKNGLAALVAGISKNLKKAEDLADPQ 576
           S FTAEARQAWKN LAALVAGI+KNLKK+EDL DPQ
Sbjct: 121 STFTAEARQAWKNXLAALVAGIAKNLKKSEDLXDPQ 156



 Score = 42.0 bits (97), Expect = 0.006
 Identities = 24/108 (22%), Positives = 48/108 (44%), Gaps = 1/108 (0%)
 Frame = +1

Query: 82  SADDASEASILSSHERSLIRKTWDQAKKDGDVAPQVLF-RFVKAHPEYQKMFSKFANVPQ 258
           S D     + L+ H+   ++++W+  +   +     +F +  K  P  QK F+KF NV  
Sbjct: 149 SEDLXDPQTKLTPHQIRDVQRSWENIRNGRNALVSSIFVKLFKETPRIQKFFAKFGNVAV 208

Query: 259 AELLSNGNFLAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRG 402
             L  N ++  Q   +   L+ +I ++  +  +   +N +   H  RG
Sbjct: 209 DSLAGNVDYEKQVALVADRLDTIISAMDDKLQLLGNINYMRYTHTERG 256



>gp:AF441745_1 [AF441745] gi:20513960  2-domain hemoglobin protein
           subunit [Daphnia spinulata]
          Length = 269

 Score =  285 bits (728), Expect = 4e-76
 Identities = 143/153 (93%), Positives = 147/153 (95%)
 Frame = +1

Query: 118 SHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQA 297
           SHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQ+ELL NGNFLAQA
Sbjct: 1   SHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQSELLGNGNFLAQA 60

Query: 298 YTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELGSGF 477
           YTILAGLNVVIQSL SQELMANQLNALGGAH+ RGATP+MFEQFGGILEEVLAEELGS F
Sbjct: 61  YTILAGLNVVIQSLFSQELMANQLNALGGAHQARGATPIMFEQFGGILEEVLAEELGSTF 120

Query: 478 TAEARQAWKNGLAALVAGISKNLKKAEDLADPQ 576
           TAEARQAWKNGLAALVAGI+KNLKK EDL DPQ
Sbjct: 121 TAEARQAWKNGLAALVAGIAKNLKKXEDLXDPQ 153



 Score = 45.1 bits (105), Expect = 7e-04
 Identities = 25/114 (21%), Positives = 51/114 (43%), Gaps = 1/114 (0%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQAKKDGDVAPQVLF-RFVKAHPEYQKMFSKFANVPQAELLSNGNFL 288
           L+ H+   ++++W+  +   +     +F +  K  P  QK F+KF NV    L  N ++ 
Sbjct: 156 LTPHQIRDVQRSWENIRNGRNALVSSIFVKLFKETPRIQKFFAKFGNVAVDSLAGNADYE 215

Query: 289 AQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEV 450
            Q   +   L+ +  ++  +  +   +N +   H  RG     +E F  +L +V
Sbjct: 216 KQVALVADXLDTIXSAMDDKLQLLGNINYMRYTHTERGIPRGPWEDFSRLLLDV 269



>prf:2512352B      hemoglobin - Daphnia magna>gp:AB021134_3
           [AB021134] gi:4589708  hemoglobin [Daphnia
           magna]>gp:AB021136_1 [AB021136] gi:4589710  hemoglobin
           [Daphnia magna]
          Length = 348

 Score =  281 bits (718), Expect = 6e-75
 Identities = 143/194 (73%), Positives = 162/194 (82%), Gaps = 2/194 (1%)
 Frame = +1

Query: 1   GVVAFVSACSQ--APGXXXXXXXXXXXXXSADDASEASILSSHERSLIRKTWDQAKKDGD 174
           G+VA  SAC+   APG             SAD+ S   ILS++ERSLIRKTWDQAKKDGD
Sbjct: 11  GIVATASACASMAAPGTTVTTVTTSVTTVSADEES-TGILSANERSLIRKTWDQAKKDGD 69

Query: 175 VAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQAYTILAGLNVVIQSLSSQEL 354
           VAPQVLFRF+KAHPEYQK FSKFA+VPQ+ELL+NGNFLAQAYTILAGLNVVIQSLSSQEL
Sbjct: 70  VAPQVLFRFIKAHPEYQKKFSKFADVPQSELLTNGNFLAQAYTILAGLNVVIQSLSSQEL 129

Query: 355 MANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELGSGFTAEARQAWKNGLAALVAGI 534
           +ANQLN LGGAH+PRG TP MFE+FG I+E+VL EELG+GF+AEARQAWK+G+ ALVAG+
Sbjct: 130 LANQLNVLGGAHQPRGVTPAMFEEFGVIVEQVLEEELGNGFSAEARQAWKHGIHALVAGV 189

Query: 535 SKNLKKAEDLADPQ 576
           SK LK  EDLADPQ
Sbjct: 190 SKTLKNPEDLADPQ 203



 Score = 58.5 bits (140), Expect = 6e-08
 Identities = 37/151 (24%), Positives = 72/151 (47%), Gaps = 1/151 (0%)
 Frame = +1

Query: 88  DDASEASILSSHERSLIRKTWDQAKKDGDVAPQVLF-RFVKAHPEYQKMFSKFANVPQAE 264
           D A   + L+ H+   ++++W+  +   +     +F +  K  P  QK F+KF++V    
Sbjct: 198 DLADPQTKLTLHQIRDVQRSWENIRSGRNALVSSIFVKLFKETPRVQKHFAKFSSVAVDS 257

Query: 265 LLSNGNFLAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILE 444
           L  + ++  Q   +   L+ +I ++  +  +   +  +   H  RG +   FE FG +L 
Sbjct: 258 LAGHADYEKQVALVADRLDTIISAMDDKLQLLGNIYYMKYTHLERGISRDTFEDFGRLLL 317

Query: 445 EVLAEELGSGFTAEARQAWKNGLAALVAGIS 537
           +VL     SG +++   +WK  LA  V G+S
Sbjct: 318 DVLG---ASGVSSDDLDSWKGVLAVFVNGVS 345



>gp:AF441741_1 [AF441741] gi:20513952  2-domain hemoglobin protein
           subunit [Daphnia spinulata]
          Length = 250

 Score =  276 bits (707), Expect = 1e-73
 Identities = 140/152 (92%), Positives = 146/152 (95%)
 Frame = +1

Query: 109 ILSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFL 288
           ILSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQ+ELL NGNFL
Sbjct: 1   ILSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQSELLGNGNFL 60

Query: 289 AQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELG 468
           AQAYTILAGLNVVIQSL SQELMANQLNALGGAH+ RGATP+MFEQFGGILEEVLAEELG
Sbjct: 61  AQAYTILAGLNVVIQSLFSQELMANQLNALGGAHQARGATPIMFEQFGGILEEVLAEELG 120

Query: 469 SGFTAEARQAWKNGLAALVAGISKNLKKAEDL 564
           S FTAEARQAWKNGLAALVAGI+KNLK  E++
Sbjct: 121 STFTAEARQAWKNGLAALVAGIAKNLKSWENI 152



 Score = 42.4 bits (98), Expect = 0.005
 Identities = 25/104 (24%), Positives = 45/104 (43%), Gaps = 1/104 (0%)
 Frame = +1

Query: 142 KTWDQAKKDGDVAPQVLF-RFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQAYTILAGL 318
           K+W+  +   +     +F +  K  P  QK F+KF NV    L  N ++  Q   +   L
Sbjct: 147 KSWENIRNGRNALVSSIFVKLFKETPRIQKFFAKFGNVAVDSLAGNVDYEKQVALVADXL 206

Query: 319 NVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEV 450
             +I ++  +  +   +N +   H  RG     +E F  +L +V
Sbjct: 207 XTIISAMDDKLQLLGNINYMRYTHTERGIPRGPWEDFSRLLLDV 250



>gp:AB055115_1 [AB055115] gi:15080671  hemoglobin chain [Moina
           macrocopa]
          Length = 348

 Score =  240 bits (612), Expect = 1e-62
 Identities = 122/192 (63%), Positives = 143/192 (73%), Gaps = 2/192 (1%)
 Frame = +1

Query: 7   VAFVSACSQAPGX--XXXXXXXXXXXXSADDASEASILSSHERSLIRKTWDQAKKDGDVA 180
           +A   A   APG               SA D+ ++ +LS+ +R++IRKTW+QA+KDGDVA
Sbjct: 12  LAVAYASQYAPGSVVTTVTSSTTTTTVSAGDSDDSGLLSASDRAIIRKTWEQARKDGDVA 71

Query: 181 PQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQAYTILAGLNVVIQSLSSQELMA 360
           PQ+LFRFVKAHPEYQK+F  FA+VPQ ELL NGNFLAQAYTILAGLNVVIQSL S+EL+A
Sbjct: 72  PQILFRFVKAHPEYQKLFRSFASVPQDELLGNGNFLAQAYTILAGLNVVIQSLGSRELLA 131

Query: 361 NQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELGSGFTAEARQAWKNGLAALVAGISK 540
           NQLNALGGAH  RGATPVMF++FG I  +VLAEELGS F AEA+ AW   +  L AGI K
Sbjct: 132 NQLNALGGAHFSRGATPVMFDEFGAIAMDVLAEELGSAFNAEAKAAWTTAVRGLNAGIVK 191

Query: 541 NLKKAEDLADPQ 576
            LK  EDL DPQ
Sbjct: 192 TLKAPEDLVDPQ 203



>gp:AB055114_1 [AB055114] gi:15080669  hemoglobin chain [Moina
           macrocopa]
          Length = 348

 Score =  240 bits (612), Expect = 1e-62
 Identities = 122/192 (63%), Positives = 143/192 (73%), Gaps = 2/192 (1%)
 Frame = +1

Query: 7   VAFVSACSQAPGX--XXXXXXXXXXXXSADDASEASILSSHERSLIRKTWDQAKKDGDVA 180
           +A   A   APG               SA D+ ++ +LS+ +R++IRKTW+QA+KDGDVA
Sbjct: 12  LAVAYASQYAPGSVVTTVTSSTTTTTVSAGDSDDSGLLSASDRAIIRKTWEQARKDGDVA 71

Query: 181 PQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQAYTILAGLNVVIQSLSSQELMA 360
           PQ+LFRFVKAHPEYQK+F  FA+VPQ ELL NGNFLAQAYTILAGLNVVIQSL S+EL+A
Sbjct: 72  PQILFRFVKAHPEYQKLFRSFASVPQDELLGNGNFLAQAYTILAGLNVVIQSLGSRELLA 131

Query: 361 NQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELGSGFTAEARQAWKNGLAALVAGISK 540
           NQLNALGGAH  RGATPVMF++FG I  +VLAEELGS F AEA+ AW   +  L AGI K
Sbjct: 132 NQLNALGGAHFSRGATPVMFDEFGAIAMDVLAEELGSAFNAEAKAAWTTAVRGLNAGIVK 191

Query: 541 NLKKAEDLADPQ 576
            LK  EDL DPQ
Sbjct: 192 TLKAPEDLVDPQ 203



>gp:AB055113_1 [AB055113] gi:15080667  hemoglobin chain [Moina
           macrocopa]>gp:AB055115_2 [AB055115] gi:15080672
           hemoglobin chain [Moina macrocopa]
          Length = 348

 Score =  239 bits (610), Expect = 2e-62
 Identities = 122/192 (63%), Positives = 143/192 (73%), Gaps = 2/192 (1%)
 Frame = +1

Query: 7   VAFVSACSQAPGX--XXXXXXXXXXXXSADDASEASILSSHERSLIRKTWDQAKKDGDVA 180
           +A   A   APG               SA D+ ++ +LS+ +R++IRKTW+QA+KDGDVA
Sbjct: 12  LAVAYAHQYAPGTVVTTVTSTTTTTSVSAGDSDDSGLLSASDRAIIRKTWEQARKDGDVA 71

Query: 181 PQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQAYTILAGLNVVIQSLSSQELMA 360
           PQ+LFRFVKAHPEYQK+F  FA+VPQ ELL NGNFLAQAYTILAGLNVVIQSL S+EL+A
Sbjct: 72  PQILFRFVKAHPEYQKLFRSFASVPQDELLGNGNFLAQAYTILAGLNVVIQSLGSRELLA 131

Query: 361 NQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELGSGFTAEARQAWKNGLAALVAGISK 540
           NQLNALGGAH  RGATPVMF++FG I  +VLAEELGS F AEA+ AW   +  L AGI K
Sbjct: 132 NQLNALGGAHFSRGATPVMFDEFGAIAMDVLAEELGSAFNAEAKAAWTTAVRGLNAGIVK 191

Query: 541 NLKKAEDLADPQ 576
            LK  EDL DPQ
Sbjct: 192 TLKAPEDLVDPQ 203



>gp:AF255951_1 [AF255951] gi:7650499  hemoglobin [Daphnia magna]
          Length = 127

 Score =  224 bits (570), Expect = 9e-58
 Identities = 111/118 (94%), Positives = 115/118 (97%)
 Frame = +1

Query: 82  SADDASEASILSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQA 261
           SADD SEA +LS+HERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQ+
Sbjct: 10  SADDGSEAGLLSAHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQS 69

Query: 262 ELLSNGNFLAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGG 435
           ELLSNGNFLAQAYTILAGLNVVIQSL SQELMANQLNALGGAH+PRGATPVMFEQFGG
Sbjct: 70  ELLSNGNFLAQAYTILAGLNVVIQSLFSQELMANQLNALGGAHQPRGATPVMFEQFGG 127



>prf:1703412A      polymeric globin - Artemia sp. (brine shrimp)
          Length = 1405

 Score = 79.3 bits (194), Expect = 3e-14
 Identities = 54/167 (32%), Positives = 80/167 (47%), Gaps = 4/167 (2%)
 Frame = +1

Query: 85  ADDASEASILSSHERSLIRKTWDQAKKDGDVAPQVLF-RFVKAHPEYQKMF--SKFANVP 255
           AD     + L+  ++ +I+ +W +A+ D     Q LF R  KAHPEYQ +F    FA+VP
Sbjct: 452 ADIVDPVTHLTGRQKEMIKASWSKARTDLRSLGQELFMRMFKAHPEYQTLFVNKGFADVP 511

Query: 256 QAELLSNGNFLAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGG 435
              L  +  F++    +L G + ++Q+L         L  LG AH  R A    F  F  
Sbjct: 512 LVSLREDERFISHMANVLGGFDTLLQNLDESSYFIYSLRNLGDAHIQRKAGTQHFRSFEA 571

Query: 436 ILEEVLAEELGSGFTAEARQAWKNGLAALVAGISKNLKKA-EDLADP 573
           IL  +L E    G  A + +AWK      +  I++ LK A  + ADP
Sbjct: 572 ILIPILQE--SQGLDAASVEAWKKFFDVSIGVIAQGLKVATSEEADP 616



 Score = 65.5 bits (158), Expect = 5e-10
 Identities = 41/150 (27%), Positives = 71/150 (47%), Gaps = 1/150 (0%)
 Frame = +1

Query: 100 EASILSSHERSLIRKTWDQAKKDGDVAPQVLF-RFVKAHPEYQKMFSKFANVPQAELLSN 276
           E + LS  + + I+++W +   D      V+F R +  HPEYQ++F +F +V   +L  +
Sbjct: 146 EVTGLSCVDVANIQESWSKVSGDLKTTGSVVFQRMINGHPEYQQLFRQFRDVDLDKLGES 205

Query: 277 GNFLAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLA 456
            +F+A  + ++A  + +I  L + + + + L  LG  H  RG     F+ F   L E L 
Sbjct: 206 NSFVAHVFRVVAAFDGIIHELDNNQFIVSTLKKLGEQHIARGTDISHFQNFRVTLLEYLK 265

Query: 457 EELGSGFTAEARQAWKNGLAALVAGISKNL 546
           E   +G     + +W     A    IS  L
Sbjct: 266 E---NGMNGAQKASWNKAFDAFEKYISMGL 292



 Score = 64.3 bits (155), Expect = 1e-09
 Identities = 40/149 (26%), Positives = 74/149 (48%), Gaps = 1/149 (0%)
 Frame = +1

Query: 112  LSSHERSLIRKTWDQAKKD-GDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFL 288
            LS+ E +++++TW+  K D   V  ++     +A P YQ +F KF++VP  +L       
Sbjct: 929  LSAREVAVVKQTWNLVKPDLMGVGMRIFKSLFEAFPAYQAVFPKFSDVPLDKLEDTPAVG 988

Query: 289  AQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELG 468
              + ++   L+ +IQ+L     +A     LG  H        MF+ FG +L  +L  +LG
Sbjct: 989  KHSISVTTKLDELIQTLDEPANLALLARQLGEDHIVLRVNKPMFKSFGKVLVRLLENDLG 1048

Query: 469  SGFTAEARQAWKNGLAALVAGISKNLKKA 555
              F++ A ++W      +V  I + L+++
Sbjct: 1049 QRFSSFASRSWHKAYDVIVEYIEEGLQQS 1077



 Score = 61.2 bits (147), Expect = 1e-08
 Identities = 39/155 (25%), Positives = 73/155 (46%), Gaps = 1/155 (0%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQAKKD-GDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFL 288
           LS  E++ I  TW + + +  +V      +   AHPEYQ+MF     +P A L+ +  F 
Sbjct: 304 LSGLEKNAILSTWGKVRGNLQEVGKATFGKLFTAHPEYQQMFRFSQGMPLASLVESPKFA 363

Query: 289 AQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELG 468
           A    +++ L+  + +L+        +  LG  H  RG     FE +  +  E L E LG
Sbjct: 364 AHTQRVVSALDQTLLALNRPSDFVYMIKELGLDHINRGTDRSHFENYQVVFIEYLKETLG 423

Query: 469 SGFTAEARQAWKNGLAALVAGISKNLKKAEDLADP 573
                   +++ +    +++ +++ L++A D+ DP
Sbjct: 424 DSLDEFTVKSFNHVFEVIISFLNEGLRQA-DIVDP 457



 Score = 60.8 bits (146), Expect = 1e-08
 Identities = 41/156 (26%), Positives = 72/156 (45%), Gaps = 3/156 (1%)
 Frame = +1

Query: 100  EASILSSHERSLIRKTWDQAKKDG--DVAPQVLFRFVKAHPEYQKMFS-KFANVPQAELL 270
            +++ L++ E+  I+  W   +  G  D+A ++  R   AHPEY+ +F+ +F NV    + 
Sbjct: 768  DSNTLTALEKQSIQDIWSNLRSTGLQDLAVKIFTRLFSAHPEYKLLFTGRFGNVD--NIN 825

Query: 271  SNGNFLAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEV 450
             N  F A  + +L+  ++VI +L   E +  QL  LG  H   G T   F+ F      V
Sbjct: 826  ENAPFKAHLHRVLSAFDIVISTLDDSEHLIRQLKDLGLFHTRLGMTRSHFDNFATAFLSV 885

Query: 451  LAEELGSGFTAEARQAWKNGLAALVAGISKNLKKAE 558
              +   +  T   R++   G   +   I + L + E
Sbjct: 886  AQDIAPNQLTVLGRESLNKGFKLMHGVIEEGLLQLE 921



 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 37/138 (26%), Positives = 62/138 (44%), Gaps = 1/138 (0%)
 Frame = +1

Query: 124 ERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQAYT 303
           +++ I++TW            V      A PEY+ +F +F N+P +EL S+   L     
Sbjct: 1   DKATIKRTWATVTDLPSFGRNVFLSVFAAKPEYKNLFVEFRNIPASELASSERLLYHGGR 60

Query: 304 ILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFG-GILEEVLAEELGSGFT 480
           +L+ ++  I  + + +     L ALG  H  RG     FE F    ++E+    + S   
Sbjct: 61  VLSSIDEAIAGIDTPDRAVKTLLALGERHISRGTVRRHFEAFSYAFIDELKQRGVESADL 120

Query: 481 AEARQAWKNGLAALVAGI 534
           A  R+ W N +  L AG+
Sbjct: 121 AAWRRGWDNIVNVLEAGL 138



 Score = 58.9 bits (141), Expect = 5e-08
 Identities = 37/150 (24%), Positives = 66/150 (43%)
 Frame = +1

Query: 91   DASEASILSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELL 270
            + +  +  S+++   +++TW  AK D      ++F+ +     YQ +FS  A      L 
Sbjct: 1238 EVNPQNAFSAYDIQAVQRTWALAKPDLMGKGAMVFKQLFTDHGYQPLFSNLAQYEITGLE 1297

Query: 271  SNGNFLAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEV 450
             +      A  ++A L+ ++ SL +   +   L  LG  H PR    V F+ F      +
Sbjct: 1298 GSPELNTHARNVMAQLDTLVGSLQNSIELGQSLAQLGKDHVPRKVNRVHFKDFAEHFIPL 1357

Query: 451  LAEELGSGFTAEARQAWKNGLAALVAGISK 540
            +  +LG  FT  A  AWK     ++A I +
Sbjct: 1358 MKADLGDEFTPLAESAWKRAFDVMIATIEQ 1387



 Score = 40.0 bits (92), Expect = 0.023
 Identities = 29/114 (25%), Positives = 48/114 (41%)
 Frame = +1

Query: 172 DVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQAYTILAGLNVVIQSLSSQE 351
           ++  +V  +   AHPEY+ +F KF      EL S   F      ++   + + + +    
Sbjct: 641 EIGKRVFAKLFAAHPEYKNLFKKFEQYSVEELPSTDAFHYHISLVMNRFSSIGKVIDDNV 700

Query: 352 LMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELGSGFTAEARQAWKNGL 513
                L  LG  H  RG +   F+QF   +E  +AE      ++E     +NGL
Sbjct: 701 SFVYLLKKLGREHIKRGLSRKQFDQF---VELYIAE-----ISSELSDTGRNGL 746



>pir:S13421 polymeric globin alpha - brine shrimp (fragment)
          Length = 1405

 Score = 79.3 bits (194), Expect = 3e-14
 Identities = 54/167 (32%), Positives = 80/167 (47%), Gaps = 4/167 (2%)
 Frame = +1

Query: 85  ADDASEASILSSHERSLIRKTWDQAKKDGDVAPQVLF-RFVKAHPEYQKMF--SKFANVP 255
           AD     + L+  ++ +I+ +W +A+ D     Q LF R  KAHPEYQ +F    FA+VP
Sbjct: 452 ADIVDPVTHLTGRQKEMIKASWSKARTDLRSLGQELFMRMFKAHPEYQTLFVNKGFADVP 511

Query: 256 QAELLSNGNFLAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGG 435
              L  +  F++    +L G + ++Q+L         L  LG AH  R A    F  F  
Sbjct: 512 LVSLREDERFISHMANVLGGFDTLLQNLDESSYFIYSLRNLGDAHIQRKAGTQHFRSFEA 571

Query: 436 ILEEVLAEELGSGFTAEARQAWKNGLAALVAGISKNLKKA-EDLADP 573
           IL  +L E    G  A + +AWK      +  I++ LK A  + ADP
Sbjct: 572 ILIPILQE--SQGLDAASVEAWKKFFDVSIGVIAQGLKVATSEEADP 616



 Score = 65.5 bits (158), Expect = 5e-10
 Identities = 41/150 (27%), Positives = 71/150 (47%), Gaps = 1/150 (0%)
 Frame = +1

Query: 100 EASILSSHERSLIRKTWDQAKKDGDVAPQVLF-RFVKAHPEYQKMFSKFANVPQAELLSN 276
           E + LS  + + I+++W +   D      V+F R +  HPEYQ++F +F +V   +L  +
Sbjct: 146 EVTGLSCVDVANIQESWSKVSGDLKTTGSVVFQRMINGHPEYQQLFRQFRDVDLDKLGES 205

Query: 277 GNFLAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLA 456
            +F+A  + ++A  + +I  L + + + + L  LG  H  RG     F+ F   L E L 
Sbjct: 206 NSFVAHVFRVVAAFDGIIHELDNNQFIVSTLKKLGEQHIARGTDISHFQNFRVTLLEYLK 265

Query: 457 EELGSGFTAEARQAWKNGLAALVAGISKNL 546
           E   +G     + +W     A    IS  L
Sbjct: 266 E---NGMNGAQKASWNKAFDAFEKYISMGL 292



 Score = 64.3 bits (155), Expect = 1e-09
 Identities = 40/149 (26%), Positives = 74/149 (48%), Gaps = 1/149 (0%)
 Frame = +1

Query: 112  LSSHERSLIRKTWDQAKKD-GDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFL 288
            LS+ E +++++TW+  K D   V  ++     +A P YQ +F KF++VP  +L       
Sbjct: 929  LSAREVAVVKQTWNLVKPDLMGVGMRIFKSLFEAFPAYQAVFPKFSDVPLDKLEDTPAVG 988

Query: 289  AQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELG 468
              + ++   L+ +IQ+L     +A     LG  H        MF+ FG +L  +L  +LG
Sbjct: 989  KHSISVTTKLDELIQTLDEPANLALLARQLGEDHIVLRVNKPMFKSFGKVLVRLLENDLG 1048

Query: 469  SGFTAEARQAWKNGLAALVAGISKNLKKA 555
              F++ A ++W      +V  I + L+++
Sbjct: 1049 QRFSSFASRSWHKAYDVIVEYIEEGLQQS 1077



 Score = 61.2 bits (147), Expect = 1e-08
 Identities = 39/155 (25%), Positives = 73/155 (46%), Gaps = 1/155 (0%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQAKKD-GDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFL 288
           LS  E++ I  TW + + +  +V      +   AHPEYQ+MF     +P A L+ +  F 
Sbjct: 304 LSGLEKNAILSTWGKVRGNLQEVGKATFGKLFTAHPEYQQMFRFSQGMPLASLVESPKFA 363

Query: 289 AQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELG 468
           A    +++ L+  + +L+        +  LG  H  RG     FE +  +  E L E LG
Sbjct: 364 AHTQRVVSALDQTLLALNRPSDFVYMIKELGLDHINRGTDRSHFENYQVVFIEYLKETLG 423

Query: 469 SGFTAEARQAWKNGLAALVAGISKNLKKAEDLADP 573
                   +++ +    +++ +++ L++A D+ DP
Sbjct: 424 DSLDEFTVKSFNHVFEVIISFLNEGLRQA-DIVDP 457



 Score = 60.8 bits (146), Expect = 1e-08
 Identities = 41/156 (26%), Positives = 72/156 (45%), Gaps = 3/156 (1%)
 Frame = +1

Query: 100  EASILSSHERSLIRKTWDQAKKDG--DVAPQVLFRFVKAHPEYQKMFS-KFANVPQAELL 270
            +++ L++ E+  I+  W   +  G  D+A ++  R   AHPEY+ +F+ +F NV    + 
Sbjct: 768  DSNTLTALEKQSIQDIWSNLRSTGLQDLAVKIFTRLFSAHPEYKLLFTGRFGNVD--NIN 825

Query: 271  SNGNFLAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEV 450
             N  F A  + +L+  ++VI +L   E +  QL  LG  H   G T   F+ F      V
Sbjct: 826  ENAPFKAHLHRVLSAFDIVISTLDDSEHLIRQLKDLGLFHTRLGMTRSHFDNFATAFLSV 885

Query: 451  LAEELGSGFTAEARQAWKNGLAALVAGISKNLKKAE 558
              +   +  T   R++   G   +   I + L + E
Sbjct: 886  AQDIAPNQLTVLGRESLNKGFKLMHGVIEEGLLQLE 921



 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 37/138 (26%), Positives = 62/138 (44%), Gaps = 1/138 (0%)
 Frame = +1

Query: 124 ERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQAYT 303
           +++ I++TW            V      A PEY+ +F +F N+P +EL S+   L     
Sbjct: 1   DKATIKRTWATVTDLPSFGRNVFLSVFAAKPEYKNLFVEFRNIPASELASSERLLYHGGR 60

Query: 304 ILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFG-GILEEVLAEELGSGFT 480
           +L+ ++  I  + + +     L ALG  H  RG     FE F    ++E+    + S   
Sbjct: 61  VLSSIDEAIAGIDTPDRAVKTLLALGERHISRGTVRRHFEAFSYAFIDELKQRGVESADL 120

Query: 481 AEARQAWKNGLAALVAGI 534
           A  R+ W N +  L AG+
Sbjct: 121 AAWRRGWDNIVNVLEAGL 138



 Score = 58.9 bits (141), Expect = 5e-08
 Identities = 37/150 (24%), Positives = 66/150 (43%)
 Frame = +1

Query: 91   DASEASILSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELL 270
            + +  +  S+++   +++TW  AK D      ++F+ +     YQ +FS  A      L 
Sbjct: 1238 EVNPQNAFSAYDIQAVQRTWALAKPDLMGKGAMVFKQLFTDHGYQPLFSNLAQYEITGLE 1297

Query: 271  SNGNFLAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEV 450
             +      A  ++A L+ ++ SL +   +   L  LG  H PR    V F+ F      +
Sbjct: 1298 GSPELNTHARNVMAQLDTLVGSLQNSIELGQSLAQLGKDHVPRKVNRVHFKDFAEHFIPL 1357

Query: 451  LAEELGSGFTAEARQAWKNGLAALVAGISK 540
            +  +LG  FT  A  AWK     ++A I +
Sbjct: 1358 MKADLGDEFTPLAESAWKRAFDVMIATIEQ 1387



 Score = 40.0 bits (92), Expect = 0.023
 Identities = 29/114 (25%), Positives = 48/114 (41%)
 Frame = +1

Query: 172 DVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQAYTILAGLNVVIQSLSSQE 351
           ++  +V  +   AHPEY+ +F KF      EL S   F      ++   + + + +    
Sbjct: 641 EIGKRVFAKLFAAHPEYKNLFKKFEQYSVEELPSTDAFHYHISLVMNRFSSIGKVIDDNV 700

Query: 352 LMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELGSGFTAEARQAWKNGL 513
                L  LG  H  RG +   F+QF   +E  +AE      ++E     +NGL
Sbjct: 701 SFVYLLKKLGREHIKRGLSRKQFDQF---VELYIAE-----ISSELSDTGRNGL 746



>gp:AF104217_1 [AF104217] gi:4020136  hemoglobin T1 polymer
           precursor [Artemia salina]
          Length = 1430

 Score = 77.8 bits (190), Expect = 1e-13
 Identities = 54/167 (32%), Positives = 79/167 (46%), Gaps = 4/167 (2%)
 Frame = +1

Query: 85  ADDASEASILSSHERSLIRKTWDQAKKDGDVAPQVLF-RFVKAHPEYQKMF--SKFANVP 255
           AD     + L+  ++ +I+ +W +A+ D     Q LF R  KAHPEYQ +F    FA+VP
Sbjct: 478 ADIVDPVTHLTGRQKEMIKASWSKARTDLRSLGQELFMRMFKAHPEYQTLFVNKGFADVP 537

Query: 256 QAELLSNGNFLAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGG 435
              L  +  F++    +L G + ++Q+L         L  LG AH  R A    F  F  
Sbjct: 538 LVSLREDERFISHMANVLGGFDTLLQNLDESSYFIYSLRNLGDAHIQRKAGTQHFRSFEA 597

Query: 436 ILEEVLAEELGSGFTAEARQAWKNGLAALVAGISKNLKKA-EDLADP 573
           IL   L E    G  A + +AWK      +  I++ LK A  + ADP
Sbjct: 598 ILIPYLQE--SQGLDAASVEAWKKFFDVSIGVIAQGLKVATSEEADP 642



 Score = 65.5 bits (158), Expect = 5e-10
 Identities = 41/149 (27%), Positives = 74/149 (49%), Gaps = 1/149 (0%)
 Frame = +1

Query: 112  LSSHERSLIRKTWDQAKKD-GDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFL 288
            LS+ E +++++TW+  K D   V  ++     +A P YQ +F KF++VP  +L       
Sbjct: 955  LSAREVAVVKQTWNLVKPDLMGVGMRIFKSLFEAFPAYQAVFPKFSDVPLDKLEDTPAVG 1014

Query: 289  AQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELG 468
              A ++   L+ +IQ+L     +A     LG  H        MF+ FG +L  +L  +LG
Sbjct: 1015 KHAISVTTKLDELIQTLDEPANLALLARQLGEDHIVLRVNKPMFKSFGKVLVRLLENDLG 1074

Query: 469  SGFTAEARQAWKNGLAALVAGISKNLKKA 555
              F++ A ++W      +V  I + L+++
Sbjct: 1075 QRFSSFASRSWHKAYDVIVEYIEEGLQQS 1103



 Score = 65.5 bits (158), Expect = 5e-10
 Identities = 41/150 (27%), Positives = 71/150 (47%), Gaps = 1/150 (0%)
 Frame = +1

Query: 100 EASILSSHERSLIRKTWDQAKKDGDVAPQVLF-RFVKAHPEYQKMFSKFANVPQAELLSN 276
           E + LS  + + I+++W +   D      V+F R +  HPEYQ++F +F +V   +L  +
Sbjct: 172 EVTGLSCVDVANIQESWSKVSGDLKTTGSVVFQRMINGHPEYQQLFRQFRDVDLDKLGES 231

Query: 277 GNFLAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLA 456
            +F+A  + ++A  + +I  L + + + + L  LG  H  RG     F+ F   L E L 
Sbjct: 232 NSFVAHVFRVVAAFDGIIHELDNNQFIVSTLKKLGEQHIARGTDISHFQNFRVTLLEYLK 291

Query: 457 EELGSGFTAEARQAWKNGLAALVAGISKNL 546
           E   +G     + +W     A    IS  L
Sbjct: 292 E---NGMNGAQKASWNKAFDAFEKYISMGL 318



 Score = 63.2 bits (152), Expect = 3e-09
 Identities = 40/148 (27%), Positives = 67/148 (45%), Gaps = 1/148 (0%)
 Frame = +1

Query: 94  ASEASILSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLS 273
           A+E S +   +++ I++TW            V      A PEY+ +F +F N+P +EL S
Sbjct: 17  AAEISGILCSDKATIKRTWATVTDLPSFGRNVFLSVFAAKPEYKNLFVEFRNIPASELAS 76

Query: 274 NGNFLAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFG-GILEEV 450
           +   L     +L+ ++  I  + + +     L ALG  H  RG     FE F    ++E+
Sbjct: 77  SERLLYHGGRVLSSIDEAIAGIDTPDRAVKTLLALGERHISRGTVRRHFEAFSYAFIDEL 136

Query: 451 LAEELGSGFTAEARQAWKNGLAALVAGI 534
               + S   A  R+ W N +  L AG+
Sbjct: 137 KQRGVESADLAAWRRGWDNIVNVLEAGL 164



 Score = 61.2 bits (147), Expect = 1e-08
 Identities = 39/155 (25%), Positives = 73/155 (46%), Gaps = 1/155 (0%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQAKKD-GDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFL 288
           LS  E++ I  TW + + +  +V      +   AHPEYQ+MF     +P A L+ +  F 
Sbjct: 330 LSGLEKNAILSTWGKVRGNLQEVGKATFGKLFTAHPEYQQMFRFSQGMPLASLVESPKFA 389

Query: 289 AQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELG 468
           A    +++ L+  + +L+        +  LG  H  RG     FE +  +  E L E LG
Sbjct: 390 AHTQRVVSALDQTLLALNRPSDFVYMIKELGLDHINRGTDRSHFENYQVVFIEYLKETLG 449

Query: 469 SGFTAEARQAWKNGLAALVAGISKNLKKAEDLADP 573
                   +++ +    +++ +++ L++A D+ DP
Sbjct: 450 DSLDEFTVKSFNHVFEVIISFLNEGLRQA-DIVDP 483



 Score = 60.8 bits (146), Expect = 1e-08
 Identities = 41/156 (26%), Positives = 72/156 (45%), Gaps = 3/156 (1%)
 Frame = +1

Query: 100  EASILSSHERSLIRKTWDQAKKDG--DVAPQVLFRFVKAHPEYQKMFS-KFANVPQAELL 270
            +++ L++ E+  I+  W   +  G  D+A ++  R   AHPEY+ +F+ +F NV    + 
Sbjct: 794  DSNTLTALEKQSIQDIWSNLRSTGLQDLAVKIFTRLFSAHPEYKLLFTGRFGNVD--NIN 851

Query: 271  SNGNFLAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEV 450
             N  F A  + +L+  ++VI +L   E +  QL  LG  H   G T   F+ F      V
Sbjct: 852  ENAPFKAHLHRVLSAFDIVISTLDDSEHLIRQLKDLGLFHTRLGMTRSHFDNFATAFLSV 911

Query: 451  LAEELGSGFTAEARQAWKNGLAALVAGISKNLKKAE 558
              +   +  T   R++   G   +   I + L + E
Sbjct: 912  AQDIAPNQLTVLGRESLNKGFKLMHGVIEEGLLQLE 947



 Score = 60.1 bits (144), Expect = 2e-08
 Identities = 38/159 (23%), Positives = 69/159 (42%)
 Frame = +1

Query: 91   DASEASILSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELL 270
            + +  +  S+++   +++TW  AK D      ++F+ +     YQ +FS  A      L 
Sbjct: 1264 EVNPQNAFSAYDIQAVQRTWALAKPDLMGKGAMVFKQLFTDHGYQPLFSNLAQYEITGLE 1323

Query: 271  SNGNFLAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEV 450
             +      A  ++A L+ ++ SL +   +   L  LG  H PR    V F+ F      +
Sbjct: 1324 GSPELNTHARNVMAQLDTLVGSLQNSIELGQSLAQLGKDHVPRKVNRVHFKDFAEHFIPL 1383

Query: 451  LAEELGSGFTAEARQAWKNGLAALVAGISKNLKKAEDLA 567
            +  +LG  FT  A  AWK     ++A I +  +    +A
Sbjct: 1384 MKADLGDEFTPLAESAWKKAFDVMIATIEQGQRARRSVA 1422



 Score = 40.0 bits (92), Expect = 0.023
 Identities = 29/114 (25%), Positives = 48/114 (41%)
 Frame = +1

Query: 172 DVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQAYTILAGLNVVIQSLSSQE 351
           ++  +V  +   AHPEY+ +F KF      EL S   F      ++   + + + +    
Sbjct: 667 EIGKRVFAKLFAAHPEYKNLFKKFEQYSVEELPSTDAFHYHISLVMNRFSSIGKVIDDNV 726

Query: 352 LMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELGSGFTAEARQAWKNGL 513
                L  LG  H  RG +   F+QF   +E  +AE      ++E     +NGL
Sbjct: 727 SFVYLLKKLGREHIKRGLSRKQFDQF---VELYIAE-----ISSELSDTGRNGL 772



>gp:AF258616_1 [AF258616] gi:8101728  hemoglobin P polymer precursor
           [Parartemia zietziana]
          Length = 1431

 Score = 68.2 bits (165), Expect = 8e-11
 Identities = 49/158 (31%), Positives = 71/158 (44%), Gaps = 4/158 (2%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQAKKDGDVAPQVLF-RFVKAHPEYQKMF--SKFANVPQAELLSNGN 282
           LS  ++ +I+ +W  A+ D     Q LF R  K +PEYQ +F    FA+V   EL  +  
Sbjct: 487 LSGRQKEMIKNSWSIARTDLRFLGQELFMRMFKVNPEYQSLFVNKGFADVSMTELRGDER 546

Query: 283 FLAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEE 462
           F++    +L G + ++Q+L         L  LG AH  R      F  F  IL   L E 
Sbjct: 547 FISHMANVLRGFDTLLQNLDDTSYFVYALRNLGDAHIQRKTGTGHFRNFEAILIPYLQE- 605

Query: 463 LGSGFTAEARQAWKNGLAALVAGISKNLK-KAEDLADP 573
              G  A   +AWK      +  I++ LK    + ADP
Sbjct: 606 -SQGLNAAGVEAWKKFFDVAIGVIAQGLKVVTPEEADP 642



 Score = 66.6 bits (161), Expect = 2e-10
 Identities = 42/152 (27%), Positives = 68/152 (44%), Gaps = 1/152 (0%)
 Frame = +1

Query: 115  SSHERSLIRKTWDQAKKDGDVAPQVLFR-FVKAHPEYQKMFSKFANVPQAELLSNGNFLA 291
            S+ +   I++TW  AK D       +FR     H EYQ +FS         L  +    A
Sbjct: 1272 SAADIQAIQQTWALAKPDLMGKGATVFRNLFNEHSEYQPLFSNLVGYEVTALEGSPELNA 1331

Query: 292  QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELGS 471
             A  ++A L+V ++SL +   +   LN LG  H PR    + F++F      ++  +LG 
Sbjct: 1332 HARNVMAQLDVFVRSLENSIELGRSLNQLGKDHVPRKVNKIHFKEFAEDFVVLMKADLGE 1391

Query: 472  GFTAEARQAWKNGLAALVAGISKNLKKAEDLA 567
             FT  A  AWK     +++ I +  +    +A
Sbjct: 1392 EFTPLAESAWKKVFDVMISTIEQGQRARRSIA 1423



 Score = 65.9 bits (159), Expect = 4e-10
 Identities = 43/154 (27%), Positives = 70/154 (44%), Gaps = 1/154 (0%)
 Frame = +1

Query: 100 EASILSSHERSLIRKTWDQAKKDGDVAPQVLF-RFVKAHPEYQKMFSKFANVPQAELLSN 276
           E + LS  + + ++++W     +      +LF R +  HPEYQ +F +F  V  A L  +
Sbjct: 172 EVTGLSCVDVANVQESWFAVSANLKNTGSILFQRLINGHPEYQTLFRQFREVELANLGES 231

Query: 277 GNFLAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLA 456
             F+A  + ++A  + +I+ L +     + L  LG  H  RG     F+ F  +L   LA
Sbjct: 232 NGFVAHVFRVIAAFDGIIRELDNNAFTVSTLKRLGEQHIARGTDITHFQNFRIVLLAYLA 291

Query: 457 EELGSGFTAEARQAWKNGLAALVAGISKNLKKAE 558
           E   +G T     +W     A+   IS  LK  E
Sbjct: 292 E---NGLTEAQGVSWNKAFDAIEKYISMGLKSLE 322



 Score = 61.2 bits (147), Expect = 1e-08
 Identities = 38/141 (26%), Positives = 65/141 (45%), Gaps = 1/141 (0%)
 Frame = +1

Query: 121 HERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQAY 300
           ++++ I++TW            V        PEY+ +F +F N+P +EL ++   L    
Sbjct: 26  NDKATIKRTWSIVTDLPSFGRNVFLTVFAYKPEYKDLFVEFRNIPASELANSDRLLYHGS 85

Query: 301 TILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFG-GILEEVLAEELGSGF 477
            +L  +N VI S+ S + +  +L ALG  H  RG     FE F    ++E+    +    
Sbjct: 86  RVLTSVNEVISSIDSPDQVVKKLVALGERHITRGTVRRHFEAFSYAFIDELKKMGVEPAD 145

Query: 478 TAEARQAWKNGLAALVAGISK 540
            A  R+ W + +  L AG+ K
Sbjct: 146 LAAWRRGWDSIVDILEAGLLK 166



 Score = 60.8 bits (146), Expect = 1e-08
 Identities = 41/149 (27%), Positives = 70/149 (46%), Gaps = 1/149 (0%)
 Frame = +1

Query: 112  LSSHERSLIRKTWDQAKKDGDVAPQVLFRFV-KAHPEYQKMFSKFANVPQAELLSNGNFL 288
            LS  E +++++TW+  K D       +FR + +  P Y+ +F KF +VP  +L       
Sbjct: 955  LSEREVAVVKQTWNLVKPDLMGVGMRIFRSLFETFPAYRVVFPKFGDVPLNQLADIPAVG 1014

Query: 289  AQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELG 468
              A  + A L+ +IQ+L     +A     LG  H        MF+ FG +L  +L  +LG
Sbjct: 1015 KHAIAVTAKLDQLIQTLDEPANLALLARQLGEDHIVLQVNRPMFKNFGTVLVRLLENDLG 1074

Query: 469  SGFTAEARQAWKNGLAALVAGISKNLKKA 555
              F+  A +AW      +   I + L+++
Sbjct: 1075 QKFSNYASKAWHKAYNVITEYIEEGLQQS 1103



 Score = 60.1 bits (144), Expect = 2e-08
 Identities = 39/156 (25%), Positives = 74/156 (47%), Gaps = 3/156 (1%)
 Frame = +1

Query: 100  EASILSSHERSLIRKTWDQAKKDG--DVAPQVLFRFVKAHPEYQKMF-SKFANVPQAELL 270
            ++  L++ E+  I   W   +  G  ++A ++  +  +AHPEY+ +F ++F NV    + 
Sbjct: 794  DSKALTALEKQSILDIWTNLRSVGLEELAVKMFTKLFEAHPEYKLLFTNRFGNVD--NIA 851

Query: 271  SNGNFLAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEV 450
             N  F A  + +L+  ++VI +L +  L+  QL  LG  H   G T   F+ F      V
Sbjct: 852  ENAPFRAHLHRVLSAFDIVIYNLDNNALLIRQLRDLGVFHTRLGMTRAHFDNFATAFFSV 911

Query: 451  LAEELGSGFTAEARQAWKNGLAALVAGISKNLKKAE 558
                + +  T   R++   G   +++ I + L + E
Sbjct: 912  AEAIVPNQLTVLGRESMNKGFKLMISVIEEGLLQLE 947



 Score = 55.1 bits (131), Expect = 7e-07
 Identities = 38/155 (24%), Positives = 69/155 (44%), Gaps = 1/155 (0%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQAKKDGDVAPQVLF-RFVKAHPEYQKMFSKFANVPQAELLSNGNFL 288
           LS  E+  I   W + + +     +  F +   AHPEYQ+MF  F +V   EL+ +  F 
Sbjct: 330 LSGLEKKAILNAWGKVRGNIQGVGKATFAKLFTAHPEYQQMFRFFRDVELTELVESPKFA 389

Query: 289 AQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELG 468
           A    +++ L+  + +L         +  LG  H  RG     FE +  +  E L E LG
Sbjct: 390 AHTQRVVSALDQTLLALDKPSDFVYMIKELGLDHINRGTDRSHFENYQVVFIEYLKETLG 449

Query: 469 SGFTAEARQAWKNGLAALVAGISKNLKKAEDLADP 573
                   ++  +    ++  +++ L++A ++ DP
Sbjct: 450 DSVDEFTVKSSNHVFEVIINFLNEGLRQA-NIVDP 483



 Score = 35.8 bits (81), Expect = 0.44
 Identities = 23/103 (22%), Positives = 43/103 (41%)
 Frame = +1

Query: 157 AKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQAYTILAGLNVVIQS 336
           A ++ ++  +V  +   AHPEY+ +F KF       L S  +F      ++     + ++
Sbjct: 662 APRNVEIGKRVFAKLFAAHPEYKNLFKKFEQHSVEVLPSTDDFDHHISLVMNRFTSIGKA 721

Query: 337 LSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEEL 465
           +         L  LG  H  RG +   F+ F  +    ++ EL
Sbjct: 722 IDDNASFVYLLKKLGREHIKRGLSRKQFDLFVELYIAEISPEL 764



>gp:AF104216_1 [AF104216] gi:4020134  hemoglobin C1 polymer
           precursor [Artemia salina]
          Length = 1430

 Score = 67.0 bits (162), Expect = 2e-10
 Identities = 42/150 (28%), Positives = 70/150 (46%), Gaps = 1/150 (0%)
 Frame = +1

Query: 94  ASEASILSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLS 273
           A+E   +   +++ I++TW            V      A PEY+ +F +F N+P +EL +
Sbjct: 17  AAEVRGILCSDKATIKRTWSIVNDLPSFGRNVFLSVFAAKPEYKNLFVEFRNIPASELAN 76

Query: 274 NGNFLAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFG-GILEEV 450
           +   L     +LA ++ VI  + S +  A +L ALG  H  RG     FE F    ++E+
Sbjct: 77  SERLLYHGGRVLASIDEVISEIDSPDSAAKKLVALGERHITRGTVRRHFEAFSYAFIDEL 136

Query: 451 LAEELGSGFTAEARQAWKNGLAALVAGISK 540
               + S   A  R+ W + +  L AG+ K
Sbjct: 137 KQRGVASADLAAWRKGWDSIVDILEAGLLK 166



 Score = 62.8 bits (151), Expect = 3e-09
 Identities = 41/149 (27%), Positives = 71/149 (47%), Gaps = 1/149 (0%)
 Frame = +1

Query: 112  LSSHERSLIRKTWDQAKKD-GDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFL 288
            LS  E  ++++TW+  K D   V  ++     +  P YQ +F KF++VP  +L       
Sbjct: 955  LSVREVEVVKQTWNLVKPDLMGVGMRIFKSLFEKFPAYQAVFPKFSDVPLDKLEDIPAVG 1014

Query: 289  AQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELG 468
              A ++   L+ +IQ+L     +A     LG  H   G    MF+ FG +L  +L  +LG
Sbjct: 1015 KHAISVTTKLDELIQTLDEPANLALLARQLGEDHIVLGVNKPMFKSFGEVLVRLLENDLG 1074

Query: 469  SGFTAEARQAWKNGLAALVAGISKNLKKA 555
              F+  A ++W      +V  I + L+++
Sbjct: 1075 QRFSNFASKSWHRAYDVIVEYIEEGLQQS 1103



 Score = 62.8 bits (151), Expect = 3e-09
 Identities = 42/151 (27%), Positives = 63/151 (40%)
 Frame = +1

Query: 115  SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQ 294
            S+ +   I+KTW  AK D       +FR +     YQ +FS         L  +      
Sbjct: 1272 SAADIEAIQKTWALAKPDLMGKGASVFRQLFTDHGYQPLFSNLVEYEVTGLEGSPELNTH 1331

Query: 295  AYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELGSG 474
            A  ++A L+ ++ SL +   +   LN LG  H PR    V F+ F      ++   LG  
Sbjct: 1332 ARNVMAQLDTLVGSLQNSIELGKSLNQLGKDHVPRKVNKVHFDDFAEHFVPLMKANLGDE 1391

Query: 475  FTAEARQAWKNGLAALVAGISKNLKKAEDLA 567
            FT  A  AWK     +VA I +  +    +A
Sbjct: 1392 FTPLAESAWKKAFNVMVATIEQGQRARRSIA 1422



 Score = 60.8 bits (146), Expect = 1e-08
 Identities = 40/155 (25%), Positives = 73/155 (46%), Gaps = 1/155 (0%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQAKKD-GDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFL 288
           LS  E++ I  TW + + +  +V      +   AHPEYQ+MF  F  V  AEL+ +  F 
Sbjct: 330 LSGLEKNAILNTWGKVRGNLQEVGKATFGKLFAAHPEYQQMFRFFQGVQLAELVDSPKFA 389

Query: 289 AQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELG 468
           A    +++ L+  + +L+        +  LG  H  RG     FE +  +  E L E LG
Sbjct: 390 AHTQRVVSALDQTLLALNRPSDFVYMIKELGLDHINRGTDRSHFENYQVVFVEYLKETLG 449

Query: 469 SGFTAEARQAWKNGLAALVAGISKNLKKAEDLADP 573
                   +++ +    ++  +++ L++A ++ DP
Sbjct: 450 DSVDEFTVKSFNHVFEVIINFLNEGLRQA-NVVDP 483



 Score = 60.1 bits (144), Expect = 2e-08
 Identities = 40/151 (26%), Positives = 70/151 (45%), Gaps = 1/151 (0%)
 Frame = +1

Query: 100 EASILSSHERSLIRKTWDQAKKDGDVAPQVLF-RFVKAHPEYQKMFSKFANVPQAELLSN 276
           E + LS  + + ++++W     +      +LF R +  HPEYQ++F +F +V  A+L  +
Sbjct: 172 EVTGLSCVDVANVQESWATVSANLKNTGSILFQRLINDHPEYQQLFRQFRDVELAKLGES 231

Query: 277 GNFLAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLA 456
             F+A  + ++A  + +I+ L +   + + L  LG  H  RG     F+ F   L   L 
Sbjct: 232 NGFVAHVFRVVAAFDGIIKELDNNPFIVSTLKRLGEQHIARGTDISHFQNFRTTLLVYLN 291

Query: 457 EELGSGFTAEARQAWKNGLAALVAGISKNLK 549
           E   +G       +W     A+   IS  LK
Sbjct: 292 E---NGMNQAQEASWNKAFDAIEKYISIGLK 319



 Score = 60.1 bits (144), Expect = 2e-08
 Identities = 44/161 (27%), Positives = 77/161 (47%), Gaps = 3/161 (1%)
 Frame = +1

Query: 100  EASILSSHERSLIRKTWDQAKKDG--DVAPQVLFRFVKAHPEYQKMFS-KFANVPQAELL 270
            ++  L++ E+  I+  W   +  G  ++A ++  R    HPEY+ +F+ +  NV    + 
Sbjct: 794  DSKALTALEKQSIQDIWTSLRPTGLEELAVKMFTRLFADHPEYKLLFTGRLGNVD--NIN 851

Query: 271  SNGNFLAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEV 450
             N  F A  + +L+  ++VI SL +  L+  QL  LG  H   G T   F+ F      V
Sbjct: 852  ENAPFRAHLHRVLSAFDIVITSLDNNALLIRQLKDLGLFHTRLGMTRAHFDNFATAFFSV 911

Query: 451  LAEELGSGFTAEARQAWKNGLAALVAGISKNLKKAEDLADP 573
              + + +  TA  R++   G   +VA I + L + E + DP
Sbjct: 912  AEDIVPNLLTALGRESLGKGFKLMVAVIEEGLLQLERI-DP 951



 Score = 39.7 bits (91), Expect = 0.030
 Identities = 29/129 (22%), Positives = 56/129 (42%), Gaps = 1/129 (0%)
 Frame = +1

Query: 82   SADDASEASILSSHERSLIRKTWDQ-AKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQ 258
            S+++A   + L   E   +R+ +   + ++ ++  +V  +   +HPEY+ +F KF     
Sbjct: 636  SSEEADPVTGLYGKEVVALRQAFAAISPRNVEIGKRVFAKLFTSHPEYKNLFKKFEQYSV 695

Query: 259  AELLSNGNFLAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGI 438
             EL S   F      ++   + V + +         L  LG  H  RG +   F+QF  +
Sbjct: 696  EELPSTDAFDYHISLVMNRFSAVGKVIDDNVSFVYLLKKLGREHIKRGLSRKQFDQFVEL 755

Query: 439  LEEVLAEEL 465
                ++ EL
Sbjct: 756  YIAEISPEL 764



>gp:TNI315608_1 [AJ315608] gi:15387694  neuroglobin [Tetraodon
           nigroviridis]>gp:TNI315609_1 [AJ315609] gi:15387696
           neuroglobin [Tetraodon nigroviridis]
          Length = 159

 Score = 65.9 bits (159), Expect = 4e-10
 Identities = 48/156 (30%), Positives = 71/156 (44%), Gaps = 3/156 (1%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQAKKDGDVAPQVLF-RFVKAHPEYQKMFSKFANVPQAE-LLSNGNF 285
           LSS ++ LIR +WD   K+      +LF R  +  PE   +F    N    +  LS+  F
Sbjct: 4   LSSKDKELIRGSWDSLGKNKVPHGVILFSRLFELDPELLNLFHYTTNCGSTQDCLSSPEF 63

Query: 286 LAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEEL 465
           L     ++  ++  +  L     + + L  LG  H+  G  P  F   G  L  +L   L
Sbjct: 64  LEHVTKVMLVIDAAVSHLDDLHSLEDFLLNLGRKHQAVGVKPQSFAMVGESLLYMLQCSL 123

Query: 466 GSGFTAEARQAWKNGLAALVAGISKN-LKKAEDLAD 570
           G  +TA  RQAW N  + +VA +S+   K  ED AD
Sbjct: 124 GQAYTASLRQAWLNMYSVVVASMSRGWAKNGEDKAD 159



>spu:HBBC_ANGAN Hemoglobin cathodic, beta chain.>sp:HBBC_ANGAN
           Hemoglobin cathodic, beta chain.>prf:2120328B    
           hemoglobin:SUBUNIT=beta - Anguilla anguilla (European
           eel)
          Length = 146

 Score = 60.8 bits (146), Expect = 1e-08
 Identities = 40/143 (27%), Positives = 69/143 (47%), Gaps = 1/143 (0%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLS-NGNFLA 291
           S+ ERS I   W +     ++ PQ L R +  +P  Q+ F KF ++  A  +  N    A
Sbjct: 4   SASERSTITSLWGKINV-AEIGPQALARVLIVYPWTQRYFGKFGDLSNAAAIQGNAKVAA 62

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELGS 471
               +L  L   ++++   +   ++L+ L   ++     P  F   G  L  VLA +LG+
Sbjct: 63  HGKVVLGALEKAVKNMDDVKGTYSKLSQLH--NEKLNVDPDNFRLLGDCLTIVLATKLGA 120

Query: 472 GFTAEARQAWKNGLAALVAGISK 540
           GF AE +  W+  +A +V+ +SK
Sbjct: 121 GFPAEIQAVWQKFVAVVVSALSK 143



>gpu:BC076983_1 [BC076983] gi:49903543  Unknown (protein for
           MGC:89562) [Xenopus tropicalis]
          Length = 179

 Score = 60.8 bits (146), Expect = 1e-08
 Identities = 39/151 (25%), Positives = 75/151 (48%), Gaps = 3/151 (1%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQAKKD-GDVAPQVLFRFVKAHPEYQKMFSKFANVPQA-ELLSNGNF 285
           ++  ER +I++TW +   +  DV   +L RF    P  ++ FS+F ++    E+  +   
Sbjct: 19  ITESERGVIKETWARVYANCEDVGVSILIRFFVNFPSAKQHFSQFKHMEDPLEMEGSVQL 78

Query: 286 LAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGAT-PVMFEQFGGILEEVLAEE 462
              A  ++  +N V+++L   E +   L+ +G +H  +    PV F+   G++ EV+AEE
Sbjct: 79  RKHARRVMGAVNSVVENLGDPEKITTVLSIVGKSHALKHKVDPVYFKILTGVMLEVIAEE 138

Query: 463 LGSGFTAEARQAWKNGLAALVAGISKNLKKA 555
               FT + + AW    + L + +    K+A
Sbjct: 139 YAKDFTPDVQLAWNKLRSHLYSHVLSAYKEA 169



>spu:HBB_TRENE Hemoglobin beta-1/2 chain.>sp:HBB_TRENE Hemoglobin
           beta-1/2 chain.>pir:C54403 hemoglobin beta chain -
           Trematomus newnesi>prf:2009293C    
           hemoglobin:SUBUNIT=beta:ISOTYPE=1/2 - Trematomus newnesi
          Length = 146

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 43/141 (30%), Positives = 72/141 (50%), Gaps = 2/141 (1%)
 Frame = +1

Query: 124 ERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLAQAY 300
           ERS+I   +     D D+ P+ L R +  +P  Q+ FS F N+  AE ++SN N  A   
Sbjct: 7   ERSIISDIFSHMDYD-DIGPKALSRCLVVYPWTQRYFSGFGNLYNAEGIMSNANVAAHGI 65

Query: 301 TILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELGSGF 477
            +L GL+   + + + + +A+    L   H  +    P  F+     +  VLA ++G  F
Sbjct: 66  KVLHGLD---RGMKNMDNIADAYTDLSTLHSEKLHVDPDNFKLLSDCITIVLAAKMGHAF 122

Query: 478 TAEARQAWKNGLAALVAGISK 540
           TAE + A++  LAA+V+ + K
Sbjct: 123 TAETQGAFQKFLAAVVSALGK 143



>spu:GLBD_CAUAR Globin D, coelomic.>sp:GLBD_CAUAR Globin D,
           coelomic.
          Length = 158

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 44/143 (30%), Positives = 65/143 (44%), Gaps = 2/143 (1%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQ--AKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNF 285
           L+  E+ LIR TWDQ    + G VA  V  R     P  Q+ F + A +  AEL ++   
Sbjct: 12  LTPAEKDLIRSTWDQLMTHRTGFVA-DVFIRIFHNDPTAQRKFPQMAGLSPAELRTSRQM 70

Query: 286 LAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEEL 465
            A A  + A +   I  + + E++   L  L   H         ++ FG +L E +  EL
Sbjct: 71  HAHAIRVSALMTTYIDEMDT-EVLPELLATLTRTHDKNHVGKKNYDLFGKVLMEAIKAEL 129

Query: 466 GSGFTAEARQAWKNGLAALVAGI 534
           G GFT +   AW     A+V G+
Sbjct: 130 GVGFTKQVHDAWAKTF-AIVQGV 151



>sp:HBB2_XENLA Hemoglobin beta-2 chain (Minor) (Larval
           beta-II-globin) (B2G).
          Length = 146

 Score = 60.1 bits (144), Expect = 2e-08
 Identities = 39/143 (27%), Positives = 68/143 (47%), Gaps = 1/143 (0%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQ-AELLSNGNFLA 291
           ++ E++ I   W +   + D     L R +  +P  Q+ FS F N+   A +  N    A
Sbjct: 4   TAEEKAAITSVWQKVNVEHD-GHDALGRLLIVYPWTQRYFSNFGNLSNSAAVAGNAKVQA 62

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELGS 471
               +L+ +   I  + S +    QL+ +          P  F++FGG+L  VL  +LG+
Sbjct: 63  HGKKVLSAVGNAISHIDSVKSSLQQLSKIHATEL--FVDPENFKRFGGVLVIVLGAKLGT 120

Query: 472 GFTAEARQAWKNGLAALVAGISK 540
            FT + + AW+  +A LV G+S+
Sbjct: 121 AFTPKVQAAWEKFIAVLVDGLSQ 143



>spu:CYGB_MOUSE Cytoglobin (Histoglobin) (HGb).>sp:CYGB_MOUSE
           Cytoglobin (Histoglobin) (HGb).>gp:AK019410_1 [AK019410]
           gi:12859604  Mus musculus 13 days embryo head cDNA,
           RIKEN full-length enriched library, clone:3110001K20
           product:Mus musculus mRNA for cytoglobin (Cygb gene),
           full insert sequence. [Mus musculus]>gp:MMU315163_1
           [AJ315163] gi:18071106  cytoglobin [Mus
           musculus]>gp:MMU315164_1 [AJ315164] gi:21727818
           cytoglobin [Mus musculus]>gpu:BC055040_1 [BC055040]
           gi:32822763  Cygb protein [Mus musculus]>gpu:AK019410_1
           [AK019410] gi:12859604  Mus musculus 13 days embryo head
           cDNA, RIKEN full-length enriched library,
           clone:3110001K20 product:Mus musculus mRNA for
           cytoglobin (Cygb gene), full insert sequence. [Mus
           musculus]
          Length = 190

 Score = 60.1 bits (144), Expect = 2e-08
 Identities = 37/133 (27%), Positives = 68/133 (50%), Gaps = 3/133 (2%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQAKKD-GDVAPQVLFRFVKAHPEYQKMFSKFANVPQA-ELLSNGNF 285
           LS  ER  ++ TW +   +  DV   +L RF    P  ++ FS+F ++    E+  +   
Sbjct: 19  LSEAERKAVQATWARLYANCEDVGVAILVRFFVNFPSAKQYFSQFRHMEDPLEMERSPQL 78

Query: 286 LAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGAT-PVMFEQFGGILEEVLAEE 462
              A  ++  LN V+++L   + +++ L  +G AH  +    P+ F+   G++ EV+AEE
Sbjct: 79  RKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPMYFKILSGVILEVIAEE 138

Query: 463 LGSGFTAEARQAW 501
             + F  E ++AW
Sbjct: 139 FANDFPVETQKAW 151



>pir:A54492 hemoglobin beta-II chain, larval - African clawed
           frog>prf:1112256A      globin betaII - Xenopus laevis
           (African clawed frog)>gp:XELB2GG_1 [M21411] gi:213962
           X.laevis beta-II-globin (B2G) gene, complete cds.
           [Xenopus laevis]>gp:XLBGL2R_1 [X03142] gi:64576  Xenopus
           laevis mRNA for larval beta II globin. [Xenopus laevis]
          Length = 147

 Score = 60.1 bits (144), Expect = 2e-08
 Identities = 39/143 (27%), Positives = 68/143 (47%), Gaps = 1/143 (0%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQ-AELLSNGNFLA 291
           ++ E++ I   W +   + D     L R +  +P  Q+ FS F N+   A +  N    A
Sbjct: 5   TAEEKAAITSVWQKVNVEHD-GHDALGRLLIVYPWTQRYFSNFGNLSNSAAVAGNAKVQA 63

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELGS 471
               +L+ +   I  + S +    QL+ +          P  F++FGG+L  VL  +LG+
Sbjct: 64  HGKKVLSAVGNAISHIDSVKSSLQQLSKIHATEL--FVDPENFKRFGGVLVIVLGAKLGT 121

Query: 472 GFTAEARQAWKNGLAALVAGISK 540
            FT + + AW+  +A LV G+S+
Sbjct: 122 AFTPKVQAAWEKFIAVLVDGLSQ 144



>pir:S15979 hemoglobin beta chain - sea cucumber (Caudina
           arenicola)>prf:1713216A      globin D - Caudina
           arenicola
          Length = 158

 Score = 59.7 bits (143), Expect = 3e-08
 Identities = 44/143 (30%), Positives = 65/143 (44%), Gaps = 2/143 (1%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQ--AKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNF 285
           L+  E+ LIR TWDQ    + G VA  V  R     P  Q+ F + A +  AEL ++   
Sbjct: 12  LTPAEKDLIRSTWDQLMTHRTGFVA-DVFIRIFHNDPWAQRKFPQMAGLSPAELRTSRQM 70

Query: 286 LAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEEL 465
            A A  + A +   I  + + E++   L  L   H         ++ FG +L E +  EL
Sbjct: 71  HAHAIRVSALMTTYIDEMDT-EVLPELLATLTRTHDKNHVGKKNYDLFGKVLMEAIKAEL 129

Query: 466 GSGFTAEARQAWKNGLAALVAGI 534
           G GFT +   AW     A+V G+
Sbjct: 130 GVGFTKQVHDAWAKTF-AIVQGV 151



>spu:CYGB_HUMAN Cytoglobin (Histoglobin) (HGb) (Stellate cell
           activation-associated protein).>sp:CYGB_HUMAN Cytoglobin
           (Histoglobin) (HGb) (Stellate cell activation-associated
           protein).>gp:AB057769_1 [AB057769] gi:19910939  stellate
           cell activation-associated protein [Homo
           sapiens]>gp:AK098057_1 [AK098057] gi:21757987  Homo
           sapiens cDNA FLJ40738 fis, clone TKIDN2004185, weakly
           similar to GLOBIN. [Homo sapiens]>gp:HSA315162_1
           [AJ315162] gi:18071104  cytoglobin [Homo
           sapiens]>gpu:AK098057_1 [AK098057] gi:21757987  Homo
           sapiens cDNA FLJ40738 fis, clone TKIDN2004185, weakly
           similar to GLOBIN. [Homo sapiens]
          Length = 190

 Score = 59.3 bits (142), Expect = 4e-08
 Identities = 38/133 (28%), Positives = 67/133 (49%), Gaps = 3/133 (2%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQAKKD-GDVAPQVLFRFVKAHPEYQKMFSKFANVPQA-ELLSNGNF 285
           LS  ER  ++  W +   +  DV   +L RF    P  ++ FS+F ++    E+  +   
Sbjct: 19  LSEAERKAVQAMWARLYANCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQL 78

Query: 286 LAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGAT-PVMFEQFGGILEEVLAEE 462
              A  ++  LN V+++L   + +++ L  +G AH  +    PV F+   G++ EV+AEE
Sbjct: 79  RKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEE 138

Query: 463 LGSGFTAEARQAW 501
             S F  E ++AW
Sbjct: 139 FASDFPPETQRAW 151



>gp:BC029798_1 [BC029798] gi:20987458  Unknown (protein for
           MGC:34702) [Homo sapiens]>gpu:BC029798_1 [BC029798]
           gi:20987458  cytoglobin [Homo sapiens]
          Length = 190

 Score = 58.9 bits (141), Expect = 5e-08
 Identities = 38/133 (28%), Positives = 66/133 (49%), Gaps = 3/133 (2%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQAKKD-GDVAPQVLFRFVKAHPEYQKMFSKFANVPQA-ELLSNGNF 285
           LS  ER  ++  W +      DV   +L RF    P  ++ FS+F ++    E+  +   
Sbjct: 19  LSEAERKAVQAMWARLYASCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQL 78

Query: 286 LAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGAT-PVMFEQFGGILEEVLAEE 462
              A  ++  LN V+++L   + +++ L  +G AH  +    PV F+   G++ EV+AEE
Sbjct: 79  RKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEE 138

Query: 463 LGSGFTAEARQAW 501
             S F  E ++AW
Sbjct: 139 FASDFPPETQRAW 151



>spu:CYGB_RAT Cytoglobin (Histoglobin) (HGb) (Stellate cell
           activation-associated protein).>sp:CYGB_RAT Cytoglobin
           (Histoglobin) (HGb) (Stellate cell activation-associated
           protein).>gp:RNO245663_1 [AJ245663] gi:15384974
           stellate cell activation-associated protein [Rattus
           norvegicus]
          Length = 190

 Score = 58.9 bits (141), Expect = 5e-08
 Identities = 36/133 (27%), Positives = 68/133 (51%), Gaps = 3/133 (2%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQAKKD-GDVAPQVLFRFVKAHPEYQKMFSKFANVPQA-ELLSNGNF 285
           LS  ER  ++ TW +   +  DV   +L RF    P  ++ FS+F ++    E+  +   
Sbjct: 19  LSEAERKAVQATWARLYANCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQL 78

Query: 286 LAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGAT-PVMFEQFGGILEEVLAEE 462
              A  ++  LN V+++L   + +++ L  +G AH  +    P+ F+   G++ +V+AEE
Sbjct: 79  RKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPMYFKILSGVILDVIAEE 138

Query: 463 LGSGFTAEARQAW 501
             + F  E ++AW
Sbjct: 139 FANDFPVETQKAW 151



>pir:HBXLT1 hemoglobin beta-T1 chain, tadpole - African clawed frog
          Length = 146

 Score = 58.5 bits (140), Expect = 6e-08
 Identities = 44/143 (30%), Positives = 69/143 (47%), Gaps = 1/143 (0%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLA 291
           LS+ E+S I   W +   + D     L R +   P  Q+ FS F N+     +S GN   
Sbjct: 3   LSADEKSAINAVWSKVNIEND-GHDALTRLLVVFPWTQRYFSSFGNLSNVAAIS-GNAKV 60

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
           +A+     L+ V +S+   + + N L+ L   H       P  F++ G +L  VLA +LG
Sbjct: 61  RAHGKKV-LSAVDESIHHLDDIKNFLSVLSTKHAEELHVDPENFKRLGDVLVIVLAGKLG 119

Query: 469 SGFTAEARQAWKNGLAALVAGIS 537
           + FT + + AW+   A LVA +S
Sbjct: 120 AAFTPQVQAAWEKFSAGLVAALS 142



>gp:AF291834_1 [AF291834] gi:9930592  myoglobin [Sarda chiliensis]
          Length = 147

 Score = 58.5 bits (140), Expect = 6e-08
 Identities = 37/123 (30%), Positives = 64/123 (51%), Gaps = 1/123 (0%)
 Frame = +1

Query: 187 VLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQAYTILAGLNVVIQSLSSQELMANQ 366
           VL R  K HPE QK+F KF  + QA++  N    A   T+L  L  ++++  +    A  
Sbjct: 25  VLTRLFKEHPETQKLFPKFTGIAQADMAGNAAISAHGATVLKKLGELLKAKGNH---AAI 81

Query: 367 LNALGGAHKPRGATPV-MFEQFGGILEEVLAEELGSGFTAEARQAWKNGLAALVAGISKN 543
           L  +  +H  +   P+  F+    I+ +V+ E+  +G  A  +QA +N +AA++A +  N
Sbjct: 82  LKPMANSHATKHKIPINNFKLISEIIVKVMQEK--AGMDAGGQQALRNVMAAVIADLEAN 139

Query: 544 LKK 552
            K+
Sbjct: 140 YKE 142



>gp:AF291832_1 [AF291832] gi:9930588  myoglobin [Thunnus alalunga]
          Length = 147

 Score = 58.5 bits (140), Expect = 6e-08
 Identities = 39/141 (27%), Positives = 69/141 (48%), Gaps = 2/141 (1%)
 Frame = +1

Query: 136 IRKTWDQAKKD-GDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQAYTILA 312
           + K W   + D   +   VL R  K HP+ QK+F KFA + QA+L  N    A   T+L 
Sbjct: 7   VLKCWGPVEADYTTIGGLVLTRLFKEHPDTQKLFPKFAGIAQADLAGNAAISAHGATVLK 66

Query: 313 GLNVVIQSLSSQELMANQLNALGGAHKPRGATPV-MFEQFGGILEEVLAEELGSGFTAEA 489
            L  ++++  S    A+ L  +  +H  +   P+  F+    +L +V+ E+  +G  A  
Sbjct: 67  KLGELLKAKGSH---ASILKPMANSHATKHKIPINNFKLISEVLVKVMQEK--AGLDAGG 121

Query: 490 RQAWKNGLAALVAGISKNLKK 552
           + A +N +  ++A +  N K+
Sbjct: 122 QTALRNVMGIIIADLEANYKE 142



>prf:0908250A      globin beta - Xenopus laevis (African clawed
           frog)
          Length = 147

 Score = 58.5 bits (140), Expect = 6e-08
 Identities = 44/143 (30%), Positives = 69/143 (47%), Gaps = 1/143 (0%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLA 291
           LS+ E+S I   W +   + D     L R +   P  Q+ FS F N+     +S GN   
Sbjct: 4   LSADEKSAINAVWSKVNIEND-GHDALTRLLVVFPWTQRYFSSFGNLSNVAAIS-GNAKV 61

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
           +A+     L+ V +S+   + + N L+ L   H       P  F++ G +L  VLA +LG
Sbjct: 62  RAHGKKV-LSAVDESIHHLDDIKNFLSVLSTKHAEELHVDPENFKRLGDVLVIVLAGKLG 120

Query: 469 SGFTAEARQAWKNGLAALVAGIS 537
           + FT + + AW+   A LVA +S
Sbjct: 121 AAFTPQVQAAWEKFSAGLVAALS 143



>spu:MYG_THUTH Myoglobin.>sp:MYG_THUTH Myoglobin.
          Length = 146

 Score = 57.8 bits (138), Expect = 1e-07
 Identities = 40/141 (28%), Positives = 68/141 (47%), Gaps = 2/141 (1%)
 Frame = +1

Query: 136 IRKTWDQAKKD-GDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQAYTILA 312
           + K W   + D   +   VL R  K HPE QK+F KFA + QA++  N    A   T+L 
Sbjct: 6   VLKCWGPVEADYTTIGGLVLTRLFKEHPETQKLFPKFAGIAQADIAGNAAVSAHGATVLK 65

Query: 313 GLNVVIQSLSSQELMANQLNALGGAHKPRGATPV-MFEQFGGILEEVLAEELGSGFTAEA 489
            L  ++++  S    A  L  L  +H  +   P+  F+    +L +V+ E+  +G  A  
Sbjct: 66  KLGELLKAKGSH---AAILKPLANSHATKHKIPINNFKLISEVLVKVMHEK--AGLDAGG 120

Query: 490 RQAWKNGLAALVAGISKNLKK 552
           + A +N +  ++A +  N K+
Sbjct: 121 QTALRNVMGIIIADLEANYKE 141



>gp:AK087408_1 [AK087408] gi:26352464  Mus musculus 0 day neonate
           eyeball cDNA, RIKEN full-length enriched library,
           clone:E130009J07 product:Mus musculus mRNA for
           cytoglobin (Cygb gene), full insert sequence. [Mus
           musculus]>gpu:AK087408_1 [AK087408] gi:26352464  Mus
           musculus 0 day neonate eyeball cDNA, RIKEN full-length
           enriched library, clone:E130009J07 product:Mus musculus
           mRNA for cytoglobin (Cygb gene), full insert sequence.
           [Mus musculus]
          Length = 190

 Score = 57.8 bits (138), Expect = 1e-07
 Identities = 36/133 (27%), Positives = 67/133 (50%), Gaps = 3/133 (2%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQAKKD-GDVAPQVLFRFVKAHPEYQKMFSKFANVPQA-ELLSNGNF 285
           LS  ER  ++ TW +   +  DV   +L R     P  ++ FS+F ++    E+  +   
Sbjct: 19  LSEAERKAVQATWARLYANCEDVGVAILVRLFVNFPSAKQYFSQFRHMEDPLEMERSPQL 78

Query: 286 LAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGAT-PVMFEQFGGILEEVLAEE 462
              A  ++  LN V+++L   + +++ L  +G AH  +    P+ F+   G++ EV+AEE
Sbjct: 79  RKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPMYFKILSGVILEVIAEE 138

Query: 463 LGSGFTAEARQAW 501
             + F  E ++AW
Sbjct: 139 FANDFPVETQKAW 151



>gp:AF291831_1 [AF291831] gi:9930586  myoglobin [Thunnus thynnus
           thynnus]>gp:AF291836_1 [AF291836] gi:9930596  myoglobin
           [Thunnus orientalis]
          Length = 147

 Score = 57.8 bits (138), Expect = 1e-07
 Identities = 40/141 (28%), Positives = 68/141 (47%), Gaps = 2/141 (1%)
 Frame = +1

Query: 136 IRKTWDQAKKD-GDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQAYTILA 312
           + K W   + D   +   VL R  K HPE QK+F KFA + QA++  N    A   T+L 
Sbjct: 7   VLKCWGPVEADYTTIGGLVLTRLFKEHPETQKLFPKFAGIAQADIAGNAAVSAHGATVLK 66

Query: 313 GLNVVIQSLSSQELMANQLNALGGAHKPRGATPV-MFEQFGGILEEVLAEELGSGFTAEA 489
            L  ++++  S    A  L  L  +H  +   P+  F+    +L +V+ E+  +G  A  
Sbjct: 67  KLGELLKAKGSH---AAILKPLANSHATKHKIPINNFKLISEVLVKVMHEK--AGLDAGG 121

Query: 490 RQAWKNGLAALVAGISKNLKK 552
           + A +N +  ++A +  N K+
Sbjct: 122 QTALRNVMGIIIADLEANYKE 142



>spu:MYG_THUAL Myoglobin.>sp:MYG_THUAL Myoglobin.>pir:MYTUY
           myoglobin [validated] - yellowfin tuna>prf:0612242A     
           myoglobin - Thunnus albacares (yellowfin tuna)
          Length = 146

 Score = 57.4 bits (137), Expect = 1e-07
 Identities = 40/141 (28%), Positives = 68/141 (47%), Gaps = 2/141 (1%)
 Frame = +1

Query: 136 IRKTWDQAKKD-GDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQAYTILA 312
           + K W   + D   +   VL R  K HPE QK+F KFA + QA++  N    A   T+L 
Sbjct: 6   VLKCWGPVEADYTTMGGLVLTRLFKEHPETQKLFPKFAGIAQADIAGNAAISAHGATVLK 65

Query: 313 GLNVVIQSLSSQELMANQLNALGGAHKPRGATPV-MFEQFGGILEEVLAEELGSGFTAEA 489
            L  ++++  S    A  L  L  +H  +   P+  F+    +L +V+ E+  +G  A  
Sbjct: 66  KLGELLKAKGSH---AAILKPLANSHATKHKIPINNFKLISEVLVKVMHEK--AGLDAGG 120

Query: 490 RQAWKNGLAALVAGISKNLKK 552
           + A +N +  ++A +  N K+
Sbjct: 121 QTALRNVMGIIIADLEANYKE 141



>gp:AF291838_1 [AF291838] gi:9930600  myoglobin [Thunnus albacares]
          Length = 147

 Score = 57.4 bits (137), Expect = 1e-07
 Identities = 40/141 (28%), Positives = 68/141 (47%), Gaps = 2/141 (1%)
 Frame = +1

Query: 136 IRKTWDQAKKD-GDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQAYTILA 312
           + K W   + D   +   VL R  K HPE QK+F KFA + QA++  N    A   T+L 
Sbjct: 7   VLKCWGPVEADYTTMGGLVLTRLFKEHPETQKLFPKFAGIAQADIAGNAAISAHGATVLK 66

Query: 313 GLNVVIQSLSSQELMANQLNALGGAHKPRGATPV-MFEQFGGILEEVLAEELGSGFTAEA 489
            L  ++++  S    A  L  L  +H  +   P+  F+    +L +V+ E+  +G  A  
Sbjct: 67  KLGELLKAKGSH---AAILKPLANSHATKHKIPINNFKLISEVLVKVMHEK--AGLDAGG 121

Query: 490 RQAWKNGLAALVAGISKNLKK 552
           + A +N +  ++A +  N K+
Sbjct: 122 QTALRNVMGIIIADLEANYKE 142



>sp:HBB_TREHA Hemoglobin beta chain.
          Length = 146

 Score = 57.0 bits (136), Expect = 2e-07
 Identities = 41/140 (29%), Positives = 70/140 (49%), Gaps = 1/140 (0%)
 Frame = +1

Query: 124 ERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLAQAY 300
           ERS+I   +     D D+ P+ L R +  +P  Q+ FS F N+  AE ++SN N  A   
Sbjct: 7   ERSIISDIFSHMDYD-DIGPKALSRCLVVYPWTQRYFSGFGNLYNAEGIMSNANVAAHGI 65

Query: 301 TILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELGSGFT 480
            +L GL+  ++++ +       L+ L    +     P  F+     +  VLA ++G  FT
Sbjct: 66  KVLHGLDRGVKNMDNIAATYADLSTLHS--EKLHVDPDNFKLLSDCITIVLAAKMGHAFT 123

Query: 481 AEARQAWKNGLAALVAGISK 540
           AE + A++  LA +V+ + K
Sbjct: 124 AETQGAFQKFLAVVVSALGK 143



>sp:HBB2_TRENE Hemoglobin beta chain.
          Length = 146

 Score = 57.0 bits (136), Expect = 2e-07
 Identities = 41/141 (29%), Positives = 71/141 (50%), Gaps = 2/141 (1%)
 Frame = +1

Query: 124 ERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLAQAY 300
           ER++I   +     D D+ P+ L R +  +P  Q+ FS F N+  AE ++ N N  A   
Sbjct: 7   ERTIISDIFSHMDYD-DIGPKALSRCLIVYPWTQRHFSGFGNLYNAEAIIGNANVAAHGI 65

Query: 301 TILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELGSGF 477
            +L GL+   + + + + +A+    L   H  +    P  F+     +  VLA ++G  F
Sbjct: 66  KVLHGLD---RGMKNMDNIADAYTDLSTLHSEKLHVDPDNFKLLSDCITIVLAAKMGHAF 122

Query: 478 TAEARQAWKNGLAALVAGISK 540
           TAE + A++  LAA+V+ + K
Sbjct: 123 TAETQGAFQKFLAAVVSALGK 143



>gpu:BC075313_1 [BC075313] gi:49670685  Unknown (protein for
           MGC:88976) [Xenopus tropicalis]
          Length = 147

 Score = 57.0 bits (136), Expect = 2e-07
 Identities = 38/143 (26%), Positives = 68/143 (46%), Gaps = 1/143 (0%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLS-NGNFLA 291
           ++ E++ I   W +     D   + L R +  +P  Q+ FS F N+  A  ++ N    A
Sbjct: 5   TADEKAAITSVWQKVDVQQD-GHEALSRLLVVYPWTQRYFSSFGNLSNAAAIAGNAKVNA 63

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELGS 471
               +L  +   IQ L + +   + L+            P  F++FG +L  VLA++LG+
Sbjct: 64  HGKKVLGAVGSTIQHLDNVKASLHDLSVTHALKLH--VDPENFKRFGEVLVIVLAKKLGT 121

Query: 472 GFTAEARQAWKNGLAALVAGISK 540
            FT +   +W+  +A LV G+S+
Sbjct: 122 AFTPKIHASWEKFIAVLVDGLSQ 144



>prf:2420495F      hemoglobin:SUBUNIT=beta - Trematomus
           hansoni>gp:AF067571_1 [AF067571] gi:3372861  hemoglobin
           beta chain [Trematomus hansoni]
          Length = 147

 Score = 57.0 bits (136), Expect = 2e-07
 Identities = 41/140 (29%), Positives = 70/140 (49%), Gaps = 1/140 (0%)
 Frame = +1

Query: 124 ERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLAQAY 300
           ERS+I   +     D D+ P+ L R +  +P  Q+ FS F N+  AE ++SN N  A   
Sbjct: 8   ERSIISDIFSHMDYD-DIGPKALSRCLVVYPWTQRYFSGFGNLYNAEGIMSNANVAAHGI 66

Query: 301 TILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELGSGFT 480
            +L GL+  ++++ +       L+ L    +     P  F+     +  VLA ++G  FT
Sbjct: 67  KVLHGLDRGVKNMDNIAATYADLSTLHS--EKLHVDPDNFKLLSDCITIVLAAKMGHAFT 124

Query: 481 AEARQAWKNGLAALVAGISK 540
           AE + A++  LA +V+ + K
Sbjct: 125 AETQGAFQKFLAVVVSALGK 144



>prf:2420495D      hemoglobin:SUBUNIT=beta - Trematomus
           newnesi>gp:AF067569_1 [AF067569] gi:3372856  hemoglobin
           beta chain [Trematomus newnesi]
          Length = 147

 Score = 57.0 bits (136), Expect = 2e-07
 Identities = 41/141 (29%), Positives = 71/141 (50%), Gaps = 2/141 (1%)
 Frame = +1

Query: 124 ERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLAQAY 300
           ER++I   +     D D+ P+ L R +  +P  Q+ FS F N+  AE ++ N N  A   
Sbjct: 8   ERTIISDIFSHMDYD-DIGPKALSRCLIVYPWTQRHFSGFGNLYNAEAIIGNANVAAHGI 66

Query: 301 TILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELGSGF 477
            +L GL+   + + + + +A+    L   H  +    P  F+     +  VLA ++G  F
Sbjct: 67  KVLHGLD---RGMKNMDNIADAYTDLSTLHSEKLHVDPDNFKLLSDCITIVLAAKMGHAF 123

Query: 478 TAEARQAWKNGLAALVAGISK 540
           TAE + A++  LAA+V+ + K
Sbjct: 124 TAETQGAFQKFLAAVVSALGK 144



>sp:HBBL_XENLA Hemoglobin beta-1 larval chain.>prf:1012303A    
           globin beta1 - Xenopus laevis (African clawed frog)
          Length = 146

 Score = 56.2 bits (134), Expect = 3e-07
 Identities = 43/143 (30%), Positives = 68/143 (47%), Gaps = 1/143 (0%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLA 291
           LS+ E+S I   W +   + D     L R +   P  Q+ FS F N+     +S GN   
Sbjct: 3   LSADEKSAINAVWSKVNIEND-GHDALTRLLVVFPWTQRYFSSFGNLSNVAAIS-GNAKV 60

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
           +A+     L+ V +S+   + + N L+ L   H       P  F++   +L  VLA +LG
Sbjct: 61  RAHGKKV-LSAVDESIHHLDDIKNFLSVLSTKHAEELHVDPENFKRLADVLVIVLAGKLG 119

Query: 469 SGFTAEARQAWKNGLAALVAGIS 537
           + FT + + AW+   A LVA +S
Sbjct: 120 AAFTPQVQAAWEKFSAGLVAALS 142



>gp:AF291833_1 [AF291833] gi:9930590  myoglobin [Makaira nigricans]
          Length = 147

 Score = 56.2 bits (134), Expect = 3e-07
 Identities = 38/142 (26%), Positives = 68/142 (47%), Gaps = 2/142 (1%)
 Frame = +1

Query: 133 LIRKTWDQAKKD-GDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQAYTIL 309
           ++ K W   + D       VL R    HPE QK+F KFA + +A++  N    A   T+L
Sbjct: 6   MVLKHWGPVEADYATHGNLVLTRLFTEHPETQKLFPKFAGIAKADMAGNAAISAHGATVL 65

Query: 310 AGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVM-FEQFGGILEEVLAEELGSGFTAE 486
             L  ++++  S    A  +  +  +H  +   P+  FE    ++ +V+ E+  +G  A 
Sbjct: 66  KKLGELLKAKGSH---AAIIKPMANSHATKHKIPIKNFELISEVIGKVMHEK--AGLDAA 120

Query: 487 ARQAWKNGLAALVAGISKNLKK 552
            ++A KN +  ++A I  N K+
Sbjct: 121 GQKALKNVMTTIIADIEANYKE 142



>pir:I51600 hemoglobin beta-1 chain - African clawed
           frog>gp:XLBGL1R_1 [X03143] gi:64572  Xenopus laevis mRNA
           for larval beta I globin. [Xenopus laevis]>gp:XLBGL3_1
           [X01084] gi:64578  beta 1-globin [Xenopus
           laevis]>gpu:BC053807_1 [BC053807] gi:32450255  MGC64479
           protein [Xenopus laevis]
          Length = 147

 Score = 56.2 bits (134), Expect = 3e-07
 Identities = 43/143 (30%), Positives = 68/143 (47%), Gaps = 1/143 (0%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLA 291
           LS+ E+S I   W +   + D     L R +   P  Q+ FS F N+     +S GN   
Sbjct: 4   LSADEKSAINAVWSKVNIEND-GHDALTRLLVVFPWTQRYFSSFGNLSNVAAIS-GNAKV 61

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
           +A+     L+ V +S+   + + N L+ L   H       P  F++   +L  VLA +LG
Sbjct: 62  RAHGKKV-LSAVDESIHHLDDIKNFLSVLSTKHAEELHVDPENFKRLADVLVIVLAGKLG 120

Query: 469 SGFTAEARQAWKNGLAALVAGIS 537
           + FT + + AW+   A LVA +S
Sbjct: 121 AAFTPQVQAAWEKFSAGLVAALS 143



>prf:2407323D      ctt-11 gene - Chironomus thummi
           thummi>gp:AF001292_5 [AF001292] gi:2155298  globin XI
           [Chironomus thummi thummi]
          Length = 167

 Score = 55.5 bits (132), Expect = 5e-07
 Identities = 39/137 (28%), Positives = 63/137 (45%), Gaps = 4/137 (2%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLA 291
           L+  +  LIR +WD+ K +      +L+   KA+P+ Q  F +FA      + + G F  
Sbjct: 20  LADDQAILIRSSWDEVKHN---EVDILYAIFKANPDIQARFPQFAGKDLDSIKTTGQFAV 76

Query: 292 QAYTILAGLNVVIQSLSSQE----LMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAE 459
            A  I+ G+   I +L   E         +NALG +H+ RG +   F +F   L   L++
Sbjct: 77  HAGRIV-GVFSEISALQPDESGISAAKTLINALGASHRGRGISKAQFNEFRASLITYLSQ 135

Query: 460 ELGSGFTAEARQAWKNG 510
            +  G      QAW+ G
Sbjct: 136 NVSWG--DNVAQAWEKG 150



>pir:B56898 hemoglobin beta chain - Bathydraco marri>prf:1905253B   
             hemoglobin:SUBUNIT=beta - Bathydraco marri
          Length = 146

 Score = 55.5 bits (132), Expect = 5e-07
 Identities = 40/143 (27%), Positives = 71/143 (48%), Gaps = 1/143 (0%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLA 291
           S  ER++I   +     D D+ P+ L R +  +P  Q+ FS F N+  A+ +L N N  A
Sbjct: 4   SDTERAIITDIFSHLDYD-DIGPKALSRCLIVYPWTQRHFSGFGNLHNADAILGNANVAA 62

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELGS 471
               +L GL+  ++++ +      +L+ L    +     P  F+     +  VLA ++G 
Sbjct: 63  HGIKVLHGLDRGVKNMDNIVAAYTELSILHS--EKLHVDPDNFKLLSDCITIVLAAKMGK 120

Query: 472 GFTAEARQAWKNGLAALVAGISK 540
            FTAE + A++  L A+V+ + K
Sbjct: 121 AFTAEIQAAFQKFLGAVVSALGK 143



>spu:HBB_LEIXA Hemoglobin beta chain.>sp:HBB_LEIXA Hemoglobin beta
           chain.
          Length = 147

 Score = 55.5 bits (132), Expect = 5e-07
 Identities = 38/142 (26%), Positives = 68/142 (47%), Gaps = 3/142 (2%)
 Frame = +1

Query: 124 ERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANV-PQAELLSNGNFLAQAY 300
           ER+ I+  W +    G++ PQ L R +  +P  Q+ F  F N+   A +L N        
Sbjct: 7   ERAAIKALWGKIDV-GEIGPQALSRLLIVYPWTQRHFKGFGNISTNAAILGNAKVAEHGK 65

Query: 301 TILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG-SG 474
           T++ GL+  +Q++ + + +  QL+     H  +    P  F   G I+   +  + G S 
Sbjct: 66  TVMGGLDRAVQNMDNIKNVYKQLSI---KHSEKIHVDPDNFRLLGEIITMCVGAKFGPSA 122

Query: 475 FTAEARQAWKNGLAALVAGISK 540
           FT E  +AW+  LA +V+ + +
Sbjct: 123 FTPEIHEAWQKFLAVVVSALGR 144



>spu:HBB1_PAGBO Hemoglobin beta-1 chain (HB 1).>sp:HBB1_PAGBO
           Hemoglobin beta-1 chain (HB 1).
          Length = 146

 Score = 55.1 bits (131), Expect = 7e-07
 Identities = 40/140 (28%), Positives = 70/140 (49%), Gaps = 1/140 (0%)
 Frame = +1

Query: 124 ERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLAQAY 300
           ERS+I   +     + D+ P+ L R +  +P  Q+ FS F N+  AE ++ N N  A   
Sbjct: 7   ERSIISDIFSHLDYE-DIGPKALSRCLIVYPWTQRHFSGFGNLYNAESIIGNANVAAHGI 65

Query: 301 TILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELGSGFT 480
            +L GL+  ++++ + E     L+ L    +     P  F+     +  VLA ++G  FT
Sbjct: 66  KVLHGLDRGLKNMDNIEATYADLSTLHS--EKLHVDPDNFKLLADCITIVLAAKMGQAFT 123

Query: 481 AEARQAWKNGLAALVAGISK 540
           AE + A++  LA +V+ + K
Sbjct: 124 AEIQGAFQKFLAVVVSALGK 143



>prf:2420495B      hemoglobin:SUBUNIT=beta - Pagothenia
           borchgrevinki (bald rockcod)>gp:AF067567_1 [AF067567]
           gi:3372850  hemoglobin beta chain [Pagothenia
           borchgrevinki]
          Length = 147

 Score = 55.1 bits (131), Expect = 7e-07
 Identities = 40/140 (28%), Positives = 70/140 (49%), Gaps = 1/140 (0%)
 Frame = +1

Query: 124 ERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLAQAY 300
           ERS+I   +     + D+ P+ L R +  +P  Q+ FS F N+  AE ++ N N  A   
Sbjct: 8   ERSIISDIFSHLDYE-DIGPKALSRCLIVYPWTQRHFSGFGNLYNAESIIGNANVAAHGI 66

Query: 301 TILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELGSGFT 480
            +L GL+  ++++ + E     L+ L    +     P  F+     +  VLA ++G  FT
Sbjct: 67  KVLHGLDRGLKNMDNIEATYADLSTLHS--EKLHVDPDNFKLLADCITIVLAAKMGQAFT 124

Query: 481 AEARQAWKNGLAALVAGISK 540
           AE + A++  LA +V+ + K
Sbjct: 125 AEIQGAFQKFLAVVVSALGK 144



>prf:1810391A      hemoglobin:ISOTYPE=1 - Pagothenia bernacchii
           (emerald rockcod)
          Length = 288

 Score = 54.7 bits (130), Expect = 9e-07
 Identities = 40/140 (28%), Positives = 69/140 (48%), Gaps = 1/140 (0%)
 Frame = +1

Query: 124 ERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLAQAY 300
           ERS+I   +     D D+ P+ L R +  +P  Q+ FS F N+  AE ++ N N  A   
Sbjct: 149 ERSIISDIFSHMDYD-DIGPKALSRCLIVYPWTQRHFSGFGNLYNAEAIIGNANVAAHGI 207

Query: 301 TILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELGSGFT 480
            +L GL+  ++++ +       L+ L    +     P  F+     +  VLA ++G  FT
Sbjct: 208 KVLHGLDRGVKNMDNIAATYADLSTLHS--EKLHVDPDNFKLLSDCITIVLAAKMGHAFT 265

Query: 481 AEARQAWKNGLAALVAGISK 540
           AE + A++  LA +V+ + K
Sbjct: 266 AETQGAFQKFLAVVVSALGK 285



>sp:HBBY_MESAU Hemoglobin beta-Y chain.
          Length = 146

 Score = 54.7 bits (130), Expect = 9e-07
 Identities = 38/143 (26%), Positives = 68/143 (46%), Gaps = 2/143 (1%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANV-PQAELLSNGNFLA 291
           ++ E++ I   WD+   +     + L R +  +P  Q+ F KF N+ P   ++ N    A
Sbjct: 4   TAEEKAAITSIWDKVDLE-KAGGETLGRLLIVYPWTQRFFEKFGNLSPPQAIMGNPRIRA 62

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
               +L  L + +Q++ + +     L+ L   H  +    P  F+  G +L  VL+  LG
Sbjct: 63  HGKKVLTSLGLAVQNMDNLKETFAHLSEL---HCDKLHVDPENFKLLGNMLVIVLSSHLG 119

Query: 469 SGFTAEARQAWKNGLAALVAGIS 537
             FTAE + AW+  +AA+   +S
Sbjct: 120 KEFTAEVQAAWQKLVAAVANALS 142



>spu:HBB_PAGBE Hemoglobin beta chain.>sp:HBB_PAGBE Hemoglobin beta
           chain.>pir:S21678 hemoglobin beta chain - emerald
           rockcod
          Length = 146

 Score = 54.7 bits (130), Expect = 9e-07
 Identities = 40/140 (28%), Positives = 69/140 (48%), Gaps = 1/140 (0%)
 Frame = +1

Query: 124 ERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLAQAY 300
           ERS+I   +     D D+ P+ L R +  +P  Q+ FS F N+  AE ++ N N  A   
Sbjct: 7   ERSIISDIFSHMDYD-DIGPKALSRCLIVYPWTQRHFSGFGNLYNAEAIIGNANVAAHGI 65

Query: 301 TILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELGSGFT 480
            +L GL+  ++++ +       L+ L    +     P  F+     +  VLA ++G  FT
Sbjct: 66  KVLHGLDRGVKNMDNIAATYADLSTLHS--EKLHVDPDNFKLLSDCITIVLAAKMGHAFT 123

Query: 481 AEARQAWKNGLAALVAGISK 540
           AE + A++  LA +V+ + K
Sbjct: 124 AETQGAFQKFLAVVVSALGK 143



>prf:2420495E      hemoglobin:SUBUNIT=beta - Trematomus
           bernacchii>gp:AF067570_1 [AF067570] gi:3372858
           hemoglobin beta chain [Trematomus bernacchii]
          Length = 147

 Score = 54.7 bits (130), Expect = 9e-07
 Identities = 40/140 (28%), Positives = 69/140 (48%), Gaps = 1/140 (0%)
 Frame = +1

Query: 124 ERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLAQAY 300
           ERS+I   +     D D+ P+ L R +  +P  Q+ FS F N+  AE ++ N N  A   
Sbjct: 8   ERSIISDIFSHMDYD-DIGPKALSRCLIVYPWTQRHFSGFGNLYNAEAIIGNANVAAHGI 66

Query: 301 TILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELGSGFT 480
            +L GL+  ++++ +       L+ L    +     P  F+     +  VLA ++G  FT
Sbjct: 67  KVLHGLDRGVKNMDNIAATYADLSTLHS--EKLHVDPDNFKLLSDCITIVLAAKMGHAFT 124

Query: 481 AEARQAWKNGLAALVAGISK 540
           AE + A++  LA +V+ + K
Sbjct: 125 AETQGAFQKFLAVVVSALGK 144



>pir:S22357 hemoglobin beta-y chain, embryonic - golden
           hamster>prf:1813163B      beta-like globin y -
           Cricetinae gen. sp. (hamster)>gp:MABYGLO_1 [X64179]
           gi:49618  embryonic beta-like y-globin genes
           [Mesocricetus auratus]
          Length = 147

 Score = 54.7 bits (130), Expect = 9e-07
 Identities = 38/143 (26%), Positives = 68/143 (46%), Gaps = 2/143 (1%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANV-PQAELLSNGNFLA 291
           ++ E++ I   WD+   +     + L R +  +P  Q+ F KF N+ P   ++ N    A
Sbjct: 5   TAEEKAAITSIWDKVDLE-KAGGETLGRLLIVYPWTQRFFEKFGNLSPPQAIMGNPRIRA 63

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
               +L  L + +Q++ + +     L+ L   H  +    P  F+  G +L  VL+  LG
Sbjct: 64  HGKKVLTSLGLAVQNMDNLKETFAHLSEL---HCDKLHVDPENFKLLGNMLVIVLSSHLG 120

Query: 469 SGFTAEARQAWKNGLAALVAGIS 537
             FTAE + AW+  +AA+   +S
Sbjct: 121 KEFTAEVQAAWQKLVAAVANALS 143



>prf:2206405B      hemoglobin:SUBUNIT=epsilon1 - Rattus norvegicus
           (Norway rat)
          Length = 146

 Score = 54.3 bits (129), Expect = 1e-06
 Identities = 38/143 (26%), Positives = 66/143 (45%), Gaps = 2/143 (1%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLA 291
           ++ E+SLI   W +   + +V  + L R +  +P  Q+ F  F N+  A  ++ N    A
Sbjct: 4   TAEEKSLINGLWSKVNVE-EVGGEALGRLLVVYPWTQRFFDSFGNLSSASAIMGNPRVKA 62

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
               +L      I++L +   + + L  L   H  +    P  F+  G +L  VLA   G
Sbjct: 63  HGKKVLTAFGETIKNLDN---LKSALAKLSELHCDKLHVDPENFKLLGNVLVIVLASHFG 119

Query: 469 SGFTAEARQAWKNGLAALVAGIS 537
           + FTAE + AW+  +A +   +S
Sbjct: 120 NEFTAEVQAAWQKLVAGVATALS 142



>spu:HBBC_CONCO Hemoglobin cathodic, beta chain.
          Length = 146

 Score = 54.3 bits (129), Expect = 1e-06
 Identities = 39/144 (27%), Positives = 65/144 (45%), Gaps = 2/144 (1%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQ-AELLSNGNFLA 291
           SS ERS I   W +     ++ PQ L R +  +P  Q+ F KF ++   A ++ N N   
Sbjct: 4   SSSERSTISTLWGKINV-AEIGPQALARVLIVYPWTQRYFGKFGDLSSVAAIVGNANGAK 62

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
              T+L  L    Q++++ + +      L   H       P  F   G  L  VLA + G
Sbjct: 63  HGRTVLQALG---QAVNNMDNIKGTYAKLSQKHSEELNVDPDNFRLLGDCLTVVLATKFG 119

Query: 469 SGFTAEARQAWKNGLAALVAGISK 540
           + F  E +  W+  +A +V+ +S+
Sbjct: 120 AEFPPEVQAVWQKFVAVVVSALSR 143



>spu:GLB1_PARCH Globin I.>sp:GLB1_PARCH Globin I.>pir:S06134
           hemoglobin I - sea cucumber (Paracaudina
           chilensis)>prf:1516151A      globin I - Paracaudina
           chilensis
          Length = 157

 Score = 54.3 bits (129), Expect = 1e-06
 Identities = 36/140 (25%), Positives = 65/140 (45%), Gaps = 1/140 (0%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAH-PEYQKMFSKFANVPQAELLSNGNFL 288
           L+  ++ ++RKTW Q  ++       LF  + A+ P  Q  F + A +  ++L S+    
Sbjct: 12  LTLAQKKIVRKTWHQLMRNKTSFVTDLFIRIFAYDPAAQNKFPQMAGMSASQLRSSRQMQ 71

Query: 289 AQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELG 468
           A A  + + ++  I+ L S +++   L  L   H      P  ++ F  +L E L  ELG
Sbjct: 72  AHAIRVSSIMSEYIEELDS-DILPELLATLARTHDLNKVGPAHYDLFAKVLMEALQAELG 130

Query: 469 SGFTAEARQAWKNGLAALVA 528
           S F  + R +W    + + A
Sbjct: 131 SDFNQKTRDSWAKAFSIVQA 150



>gpu:BC077014_1 [BC077014] gi:49900147  Unknown (protein for
           MGC:89723) [Xenopus tropicalis]
          Length = 147

 Score = 54.3 bits (129), Expect = 1e-06
 Identities = 42/146 (28%), Positives = 69/146 (46%), Gaps = 4/146 (2%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQA--KKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLS-NGN 282
           LS+ E+S I   W +   +KDG  A   L R +  +P  Q+ FS F N+     +S N  
Sbjct: 4   LSADEKSAINAVWQKVDIEKDGHEA---LTRLLVVYPWTQRYFSSFGNLSNVTAISGNAK 60

Query: 283 FLAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAE 459
                  +L+ ++  I  +     + + L+AL   H       P  F++   +L  V+A 
Sbjct: 61  VHGHGKKVLSAVDEAIHHIDD---IKHFLSALSKKHAQELHVDPENFKRLADVLAIVVAG 117

Query: 460 ELGSGFTAEARQAWKNGLAALVAGIS 537
           +LG+ FT + + AW+   A LVA +S
Sbjct: 118 KLGTAFTPQVQAAWEKFSAGLVAALS 143



>gp:RNEP1GE_1 [X56326] gi:3367724  epsilon 1 globin [Rattus
           norvegicus]
          Length = 147

 Score = 54.3 bits (129), Expect = 1e-06
 Identities = 38/143 (26%), Positives = 66/143 (45%), Gaps = 2/143 (1%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLA 291
           ++ E+SLI   W +   + +V  + L R +  +P  Q+ F  F N+  A  ++ N    A
Sbjct: 5   TAEEKSLINGLWSKVNVE-EVGGEALGRLLVVYPWTQRFFDSFGNLSSASAIMGNPRVKA 63

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
               +L      I++L +   + + L  L   H  +    P  F+  G +L  VLA   G
Sbjct: 64  HGKKVLTAFGETIKNLDN---LKSALAKLSELHCDKLHVDPENFKLLGNVLVIVLASHFG 120

Query: 469 SGFTAEARQAWKNGLAALVAGIS 537
           + FTAE + AW+  +A +   +S
Sbjct: 121 NEFTAEVQAAWQKLVAGVATALS 143



>prf:2420495A      hemoglobin:SUBUNIT=beta - Cygnodraco
           mawsoni>gp:AF067566_1 [AF067566] gi:3372847  hemoglobin
           beta chain [Cygnodraco mawsoni]
          Length = 147

 Score = 54.3 bits (129), Expect = 1e-06
 Identities = 41/144 (28%), Positives = 69/144 (47%), Gaps = 2/144 (1%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLA 291
           S  E ++I   +     D D+ P+ L R +  +P  Q+ FS F N+  AE ++ N N  A
Sbjct: 5   SKTELTIINDIFSHLDYD-DIGPKALSRCLIVYPWTQRHFSGFGNLYNAEAIIGNANVAA 63

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
               +L GL+   + L + + + +    L   H  +    P  F+     +  VLA +LG
Sbjct: 64  HGIKVLHGLD---RGLKNMDNIVDAYAELSTLHSEKLHVDPDNFKLLSDCITIVLAAKLG 120

Query: 469 SGFTAEARQAWKNGLAALVAGISK 540
             FTAE + A++  LA +V+ + K
Sbjct: 121 KAFTAETQAAFQKFLAVVVSALGK 144



>gpu:AJ628044_1 [AJ628044] gi:42661496  myoglobin [Tetraodon
           nigroviridis]
          Length = 146

 Score = 53.9 bits (128), Expect = 2e-06
 Identities = 38/142 (26%), Positives = 68/142 (47%), Gaps = 2/142 (1%)
 Frame = +1

Query: 133 LIRKTWDQAKKDGDV-APQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQAYTIL 309
           ++ K W   + D       VL R    +PE Q++F KF  + Q+EL  N    A   T+L
Sbjct: 6   MVLKFWGPVEADYSAHGGMVLTRLFTENPETQQLFPKFVGIAQSELAGNAAVSAHGATVL 65

Query: 310 AGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVM-FEQFGGILEEVLAEELGSGFTAE 486
             L  ++++  +    A  L  L  +H  +   P+  F+    ++ +V+AE+  +G  A 
Sbjct: 66  KKLGELLKAKGNH---AAILQPLANSHATKHKIPIKNFKLIAEVIGKVMAEK--AGLDAA 120

Query: 487 ARQAWKNGLAALVAGISKNLKK 552
            +QA +N +A ++A I    K+
Sbjct: 121 GQQALRNIMATIIADIDATYKE 142



>spu:NGB2_ONCMY Neuroglobin 2.
          Length = 159

 Score = 53.9 bits (128), Expect = 2e-06
 Identities = 40/149 (26%), Positives = 64/149 (42%), Gaps = 2/149 (1%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQAKKDGDVAPQVLF-RFVKAHPEYQKMFSKFANV-PQAELLSNGNF 285
           L+  ++ LIR +W+   K+      V+F R  +  P    +F    N  P  + LS+  F
Sbjct: 4   LTEKDKELIRGSWESLGKNKVPHGVVMFSRLFELEPALLNLFHYNTNCSPTQDCLSSPEF 63

Query: 286 LAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEEL 465
           L     ++  ++  +  L     + + L  LG  H+  G     F   G  L  +L   L
Sbjct: 64  LDHVTKVMLVIDAAVSHLDDLHTLEDFLLNLGKKHQAVGVNTQSFAVVGESLLYMLQCSL 123

Query: 466 GSGFTAEARQAWKNGLAALVAGISKNLKK 552
           G G+T   RQAW N    +VA +S+   K
Sbjct: 124 GHGYTGPLRQAWLNMYTIVVAAMSRGWAK 152



>gp:AY029587_1 [AY029587] gi:13989950  myoglobin [Hemitripterus
           americanus]
          Length = 142

 Score = 53.5 bits (127), Expect = 2e-06
 Identities = 38/141 (26%), Positives = 67/141 (46%), Gaps = 2/141 (1%)
 Frame = +1

Query: 133 LIRKTWDQAKKD-GDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQAYTIL 309
           L+ K W   + D       VL R    HP+ QK+F KFA + Q ++ ++    A   T+L
Sbjct: 1   LVLKCWGPVEADYAAYGSLVLTRLFTEHPDTQKLFPKFAGIAQGDMAADAGISAHGATVL 60

Query: 310 AGLNVVIQSLSSQELMANQLNALGGAHKPRGATPV-MFEQFGGILEEVLAEELGSGFTAE 486
             L  ++++  S    A  L  L  +H  +   P+  F     ++ +V+ E+  +G  A 
Sbjct: 61  RKLGELLKAKGSH---AAILKPLANSHATKHKIPINNFRLITEVIGKVMGEK--TGLDAA 115

Query: 487 ARQAWKNGLAALVAGISKNLK 549
            +QA +N +A +VA +  + K
Sbjct: 116 GQQALRNVMAIVVADMEADYK 136



>spu:HBB1_CYGMA Hemoglobin beta-1 chain.>sp:HBB1_CYGMA Hemoglobin
           beta-1 chain.>pir:S16370 hemoglobin beta-I chain -
           Antarctic dragonfish (Cygnodraco mawsoni)>prf:1715172B  
              hemoglobin:SUBUNIT=beta:ISOTYPE=1 - Cygnodraco
           mawsoni
          Length = 146

 Score = 53.5 bits (127), Expect = 2e-06
 Identities = 40/144 (27%), Positives = 69/144 (47%), Gaps = 2/144 (1%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLA 291
           S  E ++I   +     D D+ P+ L R +  +P  Q+ FS F N+  AE ++ N N  A
Sbjct: 4   SKTELTIINDIFSHLDYD-DIGPKALSRCLIVYPWTQRHFSGFGNLYNAEAIIGNANVAA 62

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
               +L GL+   + L + + + +    L   H  +    P  F+     +  VLA +LG
Sbjct: 63  HGIKVLHGLD---RGLKNMDNIVDAYAELSTLHSEKLHVDPDNFKLLSDCITIVLAAKLG 119

Query: 469 SGFTAEARQAWKNGLAALVAGISK 540
             FTAE + A++  +A +V+ + K
Sbjct: 120 KAFTAETQAAFQKFMAVVVSALGK 143



>gp:AF082662_1 [AF082662] gi:3676660  embryonic 1 beta-globin [Danio
           rerio]>gp:AL845551_2 [AL845551] gi:27802788
           SI:bY119C3.2.1 (novel beta-type globin, variant 1)
           [Danio rerio]>gpu:AY325265_1 [AY325265] gi:32264962
           embryonic beta globin e1 [Danio rerio]
          Length = 147

 Score = 53.5 bits (127), Expect = 2e-06
 Identities = 38/130 (29%), Positives = 65/130 (49%), Gaps = 2/130 (1%)
 Frame = +1

Query: 157 AKKDGDV-APQVLFRFVKAHPEYQKMFSKFANV-PQAELLSNGNFLAQAYTILAGLNVVI 330
           AK D DV  PQ L R +  +P  Q+ F+KF N+   A +L N    A   T+L GL + +
Sbjct: 17  AKADYDVIGPQALARCLIVYPWTQRYFAKFGNLYNAAAILGNPMVAAHGKTVLKGLELAV 76

Query: 331 QSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELGSGFTAEARQAWKNG 510
           +++ + +     L+ L    +     P  F      L  V+A ++G+GFT E + A++  
Sbjct: 77  KNMDNIKATYADLSVLHS--EKLHVDPDNFRLLADCLTIVVAAQMGAGFTPEVQAAFQKF 134

Query: 511 LAALVAGISK 540
           +A  V+ + +
Sbjct: 135 IAVAVSALGR 144



>spu:HBBC_HOPLI Hemoglobin cathodic, beta chain (Hb(Ca) beta
           chain).>sp:HBBC_HOPLI Hemoglobin cathodic, beta chain
           (Hb(Ca) beta chain).
          Length = 146

 Score = 53.1 bits (126), Expect = 3e-06
 Identities = 38/142 (26%), Positives = 64/142 (44%), Gaps = 1/142 (0%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLS-NGNFLA 291
           S  ER  I   W +   D ++ PQ L R +  +P  Q+ FSKF ++     +S N    A
Sbjct: 4   SDAERDAIAAIWGKIHID-EIGPQSLARVLIVYPWTQRYFSKFGDMSSVAAISGNPKVAA 62

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELGS 471
               +L  L   +++L + +   + L+ L    +     P  F   G  +  V+A + G+
Sbjct: 63  HGKVVLGALEKGVKNLDNVKATYSNLSQL--HCEKLNVDPDNFRALGDCITIVVASKFGN 120

Query: 472 GFTAEARQAWKNGLAALVAGIS 537
            FT E + AW   L+ + A +S
Sbjct: 121 AFTPELQNAWHKFLSVVAAALS 142



>pir:HBMSH0 hemoglobin beta-h0 chain - mouse>gp:MUSHBBH0_1 [J00416]
           gi:387186  minor beta-globin [Mus musculus]
          Length = 147

 Score = 53.1 bits (126), Expect = 3e-06
 Identities = 37/143 (25%), Positives = 69/143 (47%), Gaps = 2/143 (1%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLA 291
           ++ E++ I   WD+   +  V  + L R +  +P  Q+ F KF N+  A+ ++ N    A
Sbjct: 5   TAEEKAAITSIWDKVDLE-KVGGETLGRLLIVYPWTQRFFDKFGNLSSAQAIMGNPRIKA 63

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
               +L  L + ++++ + +     L+ L   H  +  A P  F+  G +L  VL+   G
Sbjct: 64  HGKKVLTSLGLAVKNMHNLKETFAHLSEL---HCDKLHADPENFKLLGNMLVIVLSSYFG 120

Query: 469 SGFTAEARQAWKNGLAALVAGIS 537
             FTAEA+ AW+  +  +   +S
Sbjct: 121 KEFTAEAQAAWQKLVVGVATALS 143



>prf:1402327A      beta globin - Xenopus tropicalis (western clawed
           frog)
          Length = 146

 Score = 52.8 bits (125), Expect = 3e-06
 Identities = 40/144 (27%), Positives = 69/144 (47%), Gaps = 3/144 (2%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQ 294
           ++ E++ I   W +   + D     L R +  +P  Q+ FS F N+     +S GN   +
Sbjct: 4   TAEEKATIASVWGKVDIEQD-GHDALSRLLVVYPWTQRYFSSFGNLSNVSAVS-GNVKVK 61

Query: 295 AY--TILAGLNVVIQSLSSQELMANQLNALGGAH-KPRGATPVMFEQFGGILEEVLAEEL 465
           A+   +L+ +   IQ L +   + + L  L  +H +     P  F++   +L  VLA +L
Sbjct: 62  AHGNKVLSAVGSAIQHLDN---VKSHLKGLSKSHVEDLHVDPENFKRLADVLVIVLAAKL 118

Query: 466 GSGFTAEARQAWKNGLAALVAGIS 537
           GS FT + +  W+   A LVA +S
Sbjct: 119 GSAFTPQVQAVWEKLNATLVAALS 142



>spu:GLBZ_CHITH Globin CTT-Z precursor (HBZ).>sp:GLBZ_CHITH Globin
           CTT-Z precursor (HBZ).>gp:CTU07703_3 [U07703] gi:473365 
           globin V [Chironomus thummi]
          Length = 163

 Score = 52.8 bits (125), Expect = 3e-06
 Identities = 37/137 (27%), Positives = 65/137 (47%), Gaps = 3/137 (2%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLA 291
           L+S E +L++ +W Q K +      +L+   KA+P+ Q  F +FA      + ++G F  
Sbjct: 19  LTSDEAALVKSSWAQVKHN---EVDILYTVFKAYPDIQARFPQFAGKDLDTIKTSGQFAT 75

Query: 292 QAYTILAGLNVVIQ---SLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEE 462
            A  I++ L+ +I    S S+   +   ++ +G  HK RG T   F +F   L   ++  
Sbjct: 76  HATRIVSFLSELIALSGSESNLSAIYGLISKMGTDHKNRGITQTQFNKFRTALVSYISSN 135

Query: 463 LGSGFTAEARQAWKNGL 513
           +  G    A  AW + L
Sbjct: 136 VAWGDNVAA--AWTHAL 150



>sp:HBB2_XENTR Hemoglobin beta-2 chain (Larval).
          Length = 146

 Score = 52.4 bits (124), Expect = 5e-06
 Identities = 40/144 (27%), Positives = 68/144 (46%), Gaps = 3/144 (2%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQ 294
           ++ E++ I   W +   + D     L R +  +P  Q+ FS F N+     +S GN   +
Sbjct: 4   TAEEKATIASVWGKVDIEQD-GHDALSRLLVVYPWTQRYFSSFGNLSNVSAVS-GNVKVK 61

Query: 295 AY--TILAGLNVVIQSLSSQELMANQLNALGGAH-KPRGATPVMFEQFGGILEEVLAEEL 465
           A+   +L+ +   IQ L     + + L  L  +H +     P  F++   +L  VLA +L
Sbjct: 62  AHGNKVLSAVGSAIQHLDD---VKSHLKGLSKSHAEDLHVDPENFKRLADVLVIVLAAKL 118

Query: 466 GSGFTAEARQAWKNGLAALVAGIS 537
           GS FT + +  W+   A LVA +S
Sbjct: 119 GSAFTPQVQAVWEKLNATLVAALS 142



>pir:HBXLLW hemoglobin beta chain, larval - western clawed
           frog>gp:XTGLB_1 [Y00501] gi:65300  beta-globin [Silurana
           tropicalis]
          Length = 147

 Score = 52.4 bits (124), Expect = 5e-06
 Identities = 40/144 (27%), Positives = 68/144 (46%), Gaps = 3/144 (2%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQ 294
           ++ E++ I   W +   + D     L R +  +P  Q+ FS F N+     +S GN   +
Sbjct: 5   TAEEKATIASVWGKVDIEQD-GHDALSRLLVVYPWTQRYFSSFGNLSNVSAVS-GNVKVK 62

Query: 295 AY--TILAGLNVVIQSLSSQELMANQLNALGGAH-KPRGATPVMFEQFGGILEEVLAEEL 465
           A+   +L+ +   IQ L     + + L  L  +H +     P  F++   +L  VLA +L
Sbjct: 63  AHGNKVLSAVGSAIQHLDD---VKSHLKGLSKSHAEDLHVDPENFKRLADVLVIVLAAKL 119

Query: 466 GSGFTAEARQAWKNGLAALVAGIS 537
           GS FT + +  W+   A LVA +S
Sbjct: 120 GSAFTPQVQAVWEKLNATLVAALS 143



>gpu:BC053176_1 [BC053176] gi:31419195  ba1 protein [Danio rerio]
          Length = 148

 Score = 52.0 bits (123), Expect = 6e-06
 Identities = 38/142 (26%), Positives = 69/142 (47%), Gaps = 3/142 (2%)
 Frame = +1

Query: 124 ERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQ-AELLSNGNFLAQAY 300
           ER+ I   W +   D ++APQ L R +  +P  Q+ F+ F N+   A ++ N    A   
Sbjct: 8   ERTAILGLWGKLNID-EIAPQALSRCLIVYPWTQRYFATFGNLSSPAAIMGNPKVAAHGR 66

Query: 301 TILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG-SG 474
           T++ GL   I+++ +   + N   AL   H  +    P  F+     +    A + G +G
Sbjct: 67  TVMGGLERAIKNMDN---IKNTYAALSVMHSEKLHVDPDNFKLLADCITVCAAMKFGQAG 123

Query: 475 FTAEARQAWKNGLAALVAGISK 540
           F A+ ++AW+  LA +V+ + +
Sbjct: 124 FNADIQEAWQKFLAVVVSALCR 145



>gp:AB034642_1 [AB034642] gi:6230896  beta hemoglobin B [Seriola
           quinqueradiata]
          Length = 148

 Score = 52.0 bits (123), Expect = 6e-06
 Identities = 37/142 (26%), Positives = 65/142 (45%), Gaps = 3/142 (2%)
 Frame = +1

Query: 124 ERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANV-PQAELLSNGNFLAQAY 300
           ER+ I   W +    G++ PQ L R +  +P  Q+ F+ F NV   A +L N        
Sbjct: 8   ERAAITSLWGKIDV-GEIGPQALTRLLIVYPWTQRHFTTFGNVSTNAAILGNPKVAQHGK 66

Query: 301 TILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG-SG 474
           T++ GL   +++L     + N    L   H  +    P  F      +   +A + G   
Sbjct: 67  TVMGGLENAVKNLDD---IKNTYAKLSRMHSEKLHVDPDNFRALAECISVCVAAKFGKQA 123

Query: 475 FTAEARQAWKNGLAALVAGISK 540
           FTA+ ++AW+  L+A+V+ + +
Sbjct: 124 FTADVQEAWQKFLSAVVSALGR 145



>sp:HBB0_MOUSE Hemoglobin beta-H0 chain.
          Length = 146

 Score = 52.0 bits (123), Expect = 6e-06
 Identities = 36/143 (25%), Positives = 68/143 (47%), Gaps = 2/143 (1%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLA 291
           ++ E++ I   WD+   +  V  + L R +  +P  Q+ F KF N+  A+ ++ N    A
Sbjct: 4   TAEEKAAITSIWDKVDLE-KVGGETLGRLLIVYPWTQRFFDKFGNLSSAQAIMGNPRIKA 62

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
               +L  L + ++++ + +     L+ L   H  +    P  F+  G +L  VL+   G
Sbjct: 63  HGKKVLTSLGLAVKNMDNLKETFAHLSEL---HCDKLHVDPENFKLLGNMLVIVLSSYFG 119

Query: 469 SGFTAEARQAWKNGLAALVAGIS 537
             FTAEA+ AW+  +  +   +S
Sbjct: 120 KEFTAEAQAAWQKLVVGVATALS 142



>spu:HBE_MOUSE Hemoglobin epsilon-Y2 chain.>sp:HBE_MOUSE Hemoglobin
           epsilon-Y2 chain.
          Length = 146

 Score = 52.0 bits (123), Expect = 6e-06
 Identities = 37/143 (25%), Positives = 66/143 (45%), Gaps = 2/143 (1%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLA 291
           ++ E++LI   W +   + +V  + L R +  +P  Q+ F  F N+  A  ++ N    A
Sbjct: 4   TAEEKTLINGLWSKVNVE-EVGGEALGRLLVVYPWTQRFFDSFGNLSSASAIMGNPRVKA 62

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
               +L      I++L +   + + L  L   H  +    P  F+  G +L  VLA   G
Sbjct: 63  HGKKVLTAFGESIKNLDN---LKSALAKLSELHCDKLHVDPENFKLLGNVLVIVLASHFG 119

Query: 469 SGFTAEARQAWKNGLAALVAGIS 537
           + FTAE + AW+  +A +   +S
Sbjct: 120 NEFTAEMQAAWQKLVAGVATALS 142



>spu:GLBC_CAUAR Globin C, coelomic.>sp:GLBC_CAUAR Globin C,
           coelomic.
          Length = 158

 Score = 52.0 bits (123), Expect = 6e-06
 Identities = 34/140 (24%), Positives = 60/140 (42%), Gaps = 1/140 (0%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQAKKDG-DVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFL 288
           L+  ++ ++RKTW Q  ++       V  R     P  Q  F + A +  ++L S+    
Sbjct: 12  LTLAQKKIVRKTWHQLMRNKTSFVTDVFIRIFAYDPSAQNKFPQMAGMSASQLRSSRQMQ 71

Query: 289 AQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELG 468
           A A  + + ++  ++ L S +++   L  L   H         +  F  +L E L  ELG
Sbjct: 72  AHAIRVSSIMSEYVEELDS-DILPELLATLARTHDLNKVGADHYNLFAKVLMEALQAELG 130

Query: 469 SGFTAEARQAWKNGLAALVA 528
           S F  + R AW    + + A
Sbjct: 131 SDFNEKTRDAWAKAFSVVQA 150



>pir:A53881 hemoglobin chain C - sea cucumber (Caudina
           arenicola)>prf:1817360A      globin:SUBUNIT=C - Caudina
           arenicola
          Length = 157

 Score = 52.0 bits (123), Expect = 6e-06
 Identities = 34/140 (24%), Positives = 60/140 (42%), Gaps = 1/140 (0%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQAKKDG-DVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFL 288
           L+  ++ ++RKTW Q  ++       V  R     P  Q  F + A +  ++L S+    
Sbjct: 11  LTLAQKKIVRKTWHQLMRNKTSFVTDVFIRIFAYDPSAQNKFPQMAGMSASQLRSSRQMQ 70

Query: 289 AQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELG 468
           A A  + + ++  ++ L S +++   L  L   H         +  F  +L E L  ELG
Sbjct: 71  AHAIRVSSIMSEYVEELDS-DILPELLATLARTHDLNKVGADHYNLFAKVLMEALQAELG 129

Query: 469 SGFTAEARQAWKNGLAALVA 528
           S F  + R AW    + + A
Sbjct: 130 SDFNEKTRDAWAKAFSVVQA 149



>sp:GLBZ_CHITP Globin CTT-Z precursor (HBZ).>pir:S21632 hemoglobin Z
           precursor - midge (Chironomus thummi piger)>prf:2122339F
                globin Z - Chironomus thummi thummi>gp:CTCTPHB_6
           [X56271] gi:7075  Ctp HbZ gene product [Chironomus
           thummi]
          Length = 163

 Score = 52.0 bits (123), Expect = 6e-06
 Identities = 36/137 (26%), Positives = 64/137 (46%), Gaps = 3/137 (2%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLA 291
           L+S E +L++ +W Q K +      +L+   KA+P+ Q  F +FA      + ++G F  
Sbjct: 19  LTSDEAALVKSSWAQVKHN---EVDILYTVFKAYPDIQARFPQFAGKDLDSIKTSGQFAT 75

Query: 292 QAYTILAGLNVVIQ---SLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEE 462
            A  I++  + +I    S S+   +   ++ +G  HK RG T   F +F   L   ++  
Sbjct: 76  HATRIVSFFSELIALSGSESNLSAIYGLISKMGTDHKNRGITQTQFNEFRTALVSYISSN 135

Query: 463 LGSGFTAEARQAWKNGL 513
           +  G    A  AW + L
Sbjct: 136 VSWGDNVAA--AWTHAL 150



>gp:AB063101_2 [AB063101] gi:17529638  beta globin type-2 [Cyprinus
           carpio]
          Length = 147

 Score = 52.0 bits (123), Expect = 6e-06
 Identities = 35/145 (24%), Positives = 71/145 (48%), Gaps = 1/145 (0%)
 Frame = +1

Query: 109 ILSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNF 285
           + +  ER+ I+  + +   + +  P+ L R +  +P  Q+ F+ F N+  AE ++SN   
Sbjct: 3   VWTDQERAYIQDIFSKLNYE-EACPKALQRTLIVYPWTQRYFTSFGNLYNAEAIMSNSKV 61

Query: 286 LAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEEL 465
            A    +L GL+  ++++   +    +L+ L    +     P  F      L  V+A  +
Sbjct: 62  AAHGVVVLHGLDRAMKNMDDIKKTYAELSVLHS--EKLHVDPDNFRLLADCLTIVIAATM 119

Query: 466 GSGFTAEARQAWKNGLAALVAGISK 540
           G+ FTA+ + AW+  LA +V+ + +
Sbjct: 120 GTSFTADVQAAWQKFLAVVVSALCR 144



>gp:MMBGCXD_2 [X14061] gi:1183930  haemoglobin beta-h0 chain [Mus
           musculus]
          Length = 147

 Score = 52.0 bits (123), Expect = 6e-06
 Identities = 36/143 (25%), Positives = 68/143 (47%), Gaps = 2/143 (1%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLA 291
           ++ E++ I   WD+   +  V  + L R +  +P  Q+ F KF N+  A+ ++ N    A
Sbjct: 5   TAEEKAAITSIWDKVDLE-KVGGETLGRLLIVYPWTQRFFDKFGNLSSAQAIMGNPRIKA 63

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
               +L  L + ++++ + +     L+ L   H  +    P  F+  G +L  VL+   G
Sbjct: 64  HGKKVLTSLGLAVKNMDNLKETFAHLSEL---HCDKLHVDPENFKLLGNMLVIVLSSYFG 120

Query: 469 SGFTAEARQAWKNGLAALVAGIS 537
             FTAEA+ AW+  +  +   +S
Sbjct: 121 KEFTAEAQAAWQKLVVGVATALS 143



>pir:HEMSY2 hemoglobin epsilon-y2 chain - mouse>prf:0802170A    
           globin beta y2 protein - Mus musculus (house
           mouse)>gp:MMBGCXD_1 [X14061] gi:1183929  haemoglobin
           epsilon chain [Mus musculus]>gp:MMBGY2_1 [V00726]
           gi:50177  beta-globin [Mus musculus]
          Length = 147

 Score = 52.0 bits (123), Expect = 6e-06
 Identities = 37/143 (25%), Positives = 66/143 (45%), Gaps = 2/143 (1%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLA 291
           ++ E++LI   W +   + +V  + L R +  +P  Q+ F  F N+  A  ++ N    A
Sbjct: 5   TAEEKTLINGLWSKVNVE-EVGGEALGRLLVVYPWTQRFFDSFGNLSSASAIMGNPRVKA 63

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
               +L      I++L +   + + L  L   H  +    P  F+  G +L  VLA   G
Sbjct: 64  HGKKVLTAFGESIKNLDN---LKSALAKLSELHCDKLHVDPENFKLLGNVLVIVLASHFG 120

Query: 469 SGFTAEARQAWKNGLAALVAGIS 537
           + FTAE + AW+  +A +   +S
Sbjct: 121 NEFTAEMQAAWQKLVAGVATALS 143



>sp:HBBB_SERQU Hemoglobin beta-B chain.
          Length = 147

 Score = 52.0 bits (123), Expect = 6e-06
 Identities = 37/142 (26%), Positives = 65/142 (45%), Gaps = 3/142 (2%)
 Frame = +1

Query: 124 ERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANV-PQAELLSNGNFLAQAY 300
           ER+ I   W +    G++ PQ L R +  +P  Q+ F+ F NV   A +L N        
Sbjct: 7   ERAAITSLWGKIDV-GEIGPQALTRLLIVYPWTQRHFTTFGNVSTNAAILGNPKVAQHGK 65

Query: 301 TILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG-SG 474
           T++ GL   +++L     + N    L   H  +    P  F      +   +A + G   
Sbjct: 66  TVMGGLENAVKNLDD---IKNTYAKLSRMHSEKLHVDPDNFRALAECISVCVAAKFGKQA 122

Query: 475 FTAEARQAWKNGLAALVAGISK 540
           FTA+ ++AW+  L+A+V+ + +
Sbjct: 123 FTADVQEAWQKFLSAVVSALGR 144



>sp:GLBV_CHITP Globin CTT-V precursor (HBV).>pir:S21633 hemoglobin V
           precursor - midge (Chironomus thummi piger)>prf:2122339G
                globin V - Chironomus thummi thummi>gp:CTCTPHB_7
           [X56271] gi:7076  Ctp HbV gene product [Chironomus
           thummi]
          Length = 163

 Score = 51.6 bits (122), Expect = 8e-06
 Identities = 40/138 (28%), Positives = 66/138 (46%), Gaps = 4/138 (2%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLA 291
           L+S E +L++ +W+Q K +      +L    KA+P+ Q  F +FA      + ++G F  
Sbjct: 19  LTSDEANLVKSSWNQVKHN---EVDILAAVFKAYPDIQAKFPQFAGKDLDSIKTSGQFAT 75

Query: 292 QAYTILAGLNVVIQSLSSQE----LMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAE 459
            A  I++ L+ +I +LS  E     +   +  LG  HK RG T   F +F   L   L+ 
Sbjct: 76  HATRIVSFLSELI-ALSGNEANLSAVYGLVKKLGVDHKNRGITQGQFNEFKTALISYLSS 134

Query: 460 ELGSGFTAEARQAWKNGL 513
            +  G    A  AW++ L
Sbjct: 135 HVSWGDNVAA--AWEHAL 150



>spu:GLB6_CHITH Globin CTT-VI precursor.>sp:GLB6_CHITH Globin CTT-VI
           precursor.>prf:2106207A      globin 6 - Chironomus
           thummi thummi>prf:2106207B      globin 6 - Chironomus
           thummi thummi>gp:U01340_1 [U01340] gi:403531
           hemeprotein [Chironomus thummi]>gp:U01341_1 [U01341]
           gi:402353  hemeprotein [Chironomus thummi]
          Length = 162

 Score = 51.2 bits (121), Expect = 1e-05
 Identities = 36/139 (25%), Positives = 60/139 (42%), Gaps = 3/139 (2%)
 Frame = +1

Query: 94  ASEASILSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLS 273
           A+ A++L++ +  L++KTW   K +      +L+   KA+P+    F +FA      +  
Sbjct: 12  AASAAVLTTEQADLVKKTWSTVKFN---EVDILYAVFKAYPDIMAKFPQFAGKDLDSIKD 68

Query: 274 NGNFLAQAYTILAGLNVVIQSLSSQE---LMANQLNALGGAHKPRGATPVMFEQFGGILE 444
           +  F   A  I++ L+ VI    S      + N    L  +HKPRG +   F +F   L 
Sbjct: 69  SAAFATHATRIVSFLSEVISLAGSDANIPAIQNLAKELATSHKPRGVSKDQFTEFRTALF 128

Query: 445 EVLAEELGSGFTAEARQAW 501
             L   +   F      AW
Sbjct: 129 TYLKAHI--NFDGPTETAW 145



>gpu:AB154423_1 [AB154423] gi:48843364  myoglobin [Auxis rochei]
          Length = 147

 Score = 50.8 bits (120), Expect = 1e-05
 Identities = 37/141 (26%), Positives = 64/141 (45%), Gaps = 2/141 (1%)
 Frame = +1

Query: 136 IRKTWDQAKKD-GDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQAYTILA 312
           + K W   + D   V   VL R  K HP+ QK+F KFA +   +L  N    A   T+L 
Sbjct: 7   VLKCWGPVEADFNTVGGMVLARLFKDHPDTQKLFPKFAGIAAGDLAGNAAVAAHGGTVLK 66

Query: 313 GLNVVIQSLSSQELMANQLNALGGAHKPRGATPV-MFEQFGGILEEVLAEELGSGFTAEA 489
            L  ++++  +    A  +  L  +H  +   P+  F+     L  V+ E+  +G  A  
Sbjct: 67  KLGELLKAKGNH---AAIIKPLANSHATKHKIPINNFKLITEALVHVMQEK--AGLDAAG 121

Query: 490 RQAWKNGLAALVAGISKNLKK 552
           + A +N +  ++A +  N K+
Sbjct: 122 QTALRNVMGIVIADLEANYKE 142



>gp:DRU50380_1 [U50380] gi:1477575  bA1 globin [Danio
           rerio]>gpu:AL929176_2 [AL929176] gi:37606096
           SI:bY187G17.2 (ba1 globin) [Danio rerio]>gpu:AL929176_4
           [AL929176] gi:37606098  SI:bY187G17.4 (novel protein
           similar to zebrafish ba1 globin (ba1)) [Danio rerio]
          Length = 148

 Score = 50.4 bits (119), Expect = 2e-05
 Identities = 37/142 (26%), Positives = 67/142 (47%), Gaps = 3/142 (2%)
 Frame = +1

Query: 124 ERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQ-AELLSNGNFLAQAY 300
           ER+ I   W +   D ++ PQ L R +  +P  Q+ F+ F N+   A ++ N    A   
Sbjct: 8   ERTAILGLWGKLNID-EIGPQALSRCLIVYPWTQRYFATFGNLSSPAAIMGNPKVAAHGR 66

Query: 301 TILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG-SG 474
           T++ GL   I+++ +   + N   AL   H  +    P  F      +    A + G +G
Sbjct: 67  TVMGGLERAIKNMDN---VKNTYAALSVMHSEKLHVDPDNFRLLADCITVCAAMKFGQAG 123

Query: 475 FTAEARQAWKNGLAALVAGISK 540
           F A+ ++AW+  LA +V+ + +
Sbjct: 124 FNADVQEAWQKFLAVVVSALCR 145



>gp:DRU50379_1 [U50379] gi:1477573  bA2 globin [Danio
           rerio]>gpu:BC059624_1 [BC059624] gi:37748762  ba1
           protein [Danio rerio]>gpu:BC076356_1 [BC076356]
           gi:49901150  Unknown (protein for MGC:92900) [Danio
           rerio]
          Length = 148

 Score = 50.4 bits (119), Expect = 2e-05
 Identities = 37/142 (26%), Positives = 68/142 (47%), Gaps = 3/142 (2%)
 Frame = +1

Query: 124 ERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQ-AELLSNGNFLAQAY 300
           ER+ I   W +   D ++ PQ L R +  +P  Q+ F+ F N+   A ++ N    A   
Sbjct: 8   ERTAILGLWGKLNID-EIGPQALSRCLIVYPWTQRYFATFGNLSSPAAIMGNPKVAAHGR 66

Query: 301 TILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG-SG 474
           T++ GL   I+++ +   + N   AL   H  +    P  F+     +    A + G +G
Sbjct: 67  TVMGGLERAIKNMDN---IKNTYAALSVMHSEKLHVDPDNFKLLADCITVCAAMKFGQAG 123

Query: 475 FTAEARQAWKNGLAALVAGISK 540
           F A+ ++AW+  LA +V+ + +
Sbjct: 124 FNADIQEAWQKFLAVVVSALCR 145



>gp:AK012501_1 [AK012501] gi:12849289  Mus musculus 11 days embryo
           whole body cDNA, RIKEN full-length enriched library,
           clone:2700067M07 product:hemoglobin Y, beta-like
           embryonic chain, full insert sequence. [Mus
           musculus]>gp:AK012897_1 [AK012897] gi:12849942  Mus
           musculus 10, 11 days embryo whole body cDNA, RIKEN
           full-length enriched library, clone:2810043G04
           product:hemoglobin Y, beta-like embryonic chain, full
           insert sequence. [Mus musculus]>gp:MUSGLOBEP_1 [M26897]
           gi:309258  Mouse epsilon-globin mRNA, complete cds. [Mus
           musculus]>gp:MUSY1GLOB_1 [M95676] gi:202432  Y1-globin
           [Mus musculus]>gpu:AK012501_1 [AK012501] gi:12849289
           Mus musculus 11 days embryo whole body cDNA, RIKEN
           full-length enriched library, clone:2700067M07
           product:hemoglobin Y, beta-like embryonic chain, full
           insert sequence. [Mus musculus]>gpu:BC057014_1
           [BC057014] gi:34784950  hemoglobin Y, beta-like
           embryonic chain [Mus musculus]>gpu:AK012897_1 [AK012897]
           gi:12849942  Mus musculus 10, 11 days embryo whole body
           cDNA, RIKEN full-length enriched library,
           clone:2810043G04 product:hemoglobin Y, beta-like
           embryonic chain, full insert sequence. [Mus musculus]
          Length = 147

 Score = 50.1 bits (118), Expect = 2e-05
 Identities = 36/143 (25%), Positives = 65/143 (45%), Gaps = 2/143 (1%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLA 291
           ++ E++LI   W +   + +V  + L R +  +P   + F  F N+  A  ++ N    A
Sbjct: 5   TAEEKTLINGLWSKVNVE-EVGGEALGRLLVVYPWTHRFFDSFGNLSSASAIMGNPRVKA 63

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
               +L      I++L +   + + L  L   H  +    P  F+  G +L  VLA   G
Sbjct: 64  HGKKVLTAFGESIKNLDN---LKSALAKLSELHCDKLHVDPENFKLLGNVLVIVLASHFG 120

Query: 469 SGFTAEARQAWKNGLAALVAGIS 537
           + FTAE + AW+  +A +   +S
Sbjct: 121 NEFTAEMQAAWQKLVAGVATALS 143



>gpu:AY450927_1 [AY450927] gi:42415679  epsilon globin [Macropus
           eugenii]
          Length = 147

 Score = 49.7 bits (117), Expect = 3e-05
 Identities = 38/146 (26%), Positives = 65/146 (44%), Gaps = 2/146 (1%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLA 291
           ++ E++ I   W +   + +   + L R +  +P  Q+ F  F N+  A  +L N    A
Sbjct: 5   TAEEKTAITSVWGKVNVE-ETGGEALGRLLVVYPWTQRFFDSFGNLSSASAILGNPKVKA 63

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
               +L  L   +++L + +   ++L+ L   H  +    P  F   G +L  VLA   G
Sbjct: 64  HGKKVLTSLGEAVKNLDNLKATFSKLSEL---HCDKLHVDPENFRLLGNVLVVVLAVHFG 120

Query: 469 SGFTAEARQAWKNGLAALVAGISKNL 546
             FT E   AW+     LVAG++  L
Sbjct: 121 KEFTPEVHAAWQK----LVAGVASAL 142



>prf:1004285A      globin betah0 - Mus musculus (house mouse)
          Length = 147

 Score = 49.7 bits (117), Expect = 3e-05
 Identities = 36/143 (25%), Positives = 67/143 (46%), Gaps = 2/143 (1%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQA-ELLSNGNFLA 291
           ++ E++ I   WD+   +  V  + L R +  +P  Q+ F KF N+  A  ++ N    A
Sbjct: 5   TAEEKAAITSIWDKVDLE-KVGGETLGRLLIVYPWTQRFFDKFGNLSSALAIMGNPRIRA 63

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
               +L  L + ++++ + +     L+ L   H  +    P  F+  G +L  VL+   G
Sbjct: 64  HGKKVLTSLGLGVKNMDNLKETFAHLSEL---HCDKLHVDPENFKLLGNMLVIVLSSYFG 120

Query: 469 SGFTAEARQAWKNGLAALVAGIS 537
             FTAEA+ AW+  +  +   +S
Sbjct: 121 KEFTAEAQAAWQKLVVGVATALS 143



>sp:HBBA_SERQU Hemoglobin beta-A chain.>gp:AB034641_1 [AB034641]
           gi:6230890  beta hemoglobin A [Seriola quinqueradiata]
          Length = 147

 Score = 49.7 bits (117), Expect = 3e-05
 Identities = 36/142 (25%), Positives = 64/142 (44%), Gaps = 3/142 (2%)
 Frame = +1

Query: 124 ERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANV-PQAELLSNGNFLAQAY 300
           ER+ I   W +    G++ PQ L R +  +P  Q+ F+ F NV   A +L N        
Sbjct: 7   ERAAISSLWGKIDV-GEIGPQALTRLLIVYPWTQRHFTTFGNVSTNAAILGNPKVAQHGK 65

Query: 301 TILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELGSG- 474
           T++ GL   +++L     + N    L   H  +    P  F      +   +A + G   
Sbjct: 66  TVMGGLENAVKNLDD---IKNTYAKLSQMHSEKLHVDPDNFRTLAECISVCVAAKFGKQV 122

Query: 475 FTAEARQAWKNGLAALVAGISK 540
           FTA+ ++AW+  L+ +V+ + +
Sbjct: 123 FTADVQEAWQKFLSVVVSALGR 144



>spu:MYG_MUSAN Myoglobin.>sp:MYG_MUSAN Myoglobin.>prf:0610174A    
           myoglobin - Mustelus antarcticus
          Length = 148

 Score = 49.7 bits (117), Expect = 3e-05
 Identities = 36/142 (25%), Positives = 58/142 (40%), Gaps = 2/142 (1%)
 Frame = +1

Query: 136 IRKTWDQAKKD-GDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQAYTILA 312
           +   W   + D   +   +L R  + +PE Q  F KF N    EL    +  AQA T+L+
Sbjct: 6   VNSVWSAVESDLTAIGQNILLRLFEQYPESQNHFPKFKNKSLGELKDTADIKAQADTVLS 65

Query: 313 GLNVVIQSLSSQELMANQLNALGGAH-KPRGATPVMFEQFGGILEEVLAEELGSGFTAEA 489
            L  +++   S    +  + AL   H       P  F +   I  +VL+E   S   A+ 
Sbjct: 66  ALGNIVKKKGSH---SQPVKALAATHITTHKIPPHYFTKITTIAVDVLSEMYPSEMNAQV 122

Query: 490 RQAWKNGLAALVAGISKNLKKA 555
           + A+      + + I K  K A
Sbjct: 123 QAAFSGAFKIICSDIEKEYKAA 144



>spu:GLB2_CHITH Globin CTT-II beta precursor.>sp:GLB2_CHITH Globin
           CTT-II beta precursor.>prf:2009347A    
           globin:ISOTYPE=II beta - Chironomus thummi>gp:AF001292_3
           [AF001292] gi:2155295  globin II-beta [Chironomus thummi
           thummi]
          Length = 160

 Score = 49.3 bits (116), Expect = 4e-05
 Identities = 37/143 (25%), Positives = 61/143 (41%), Gaps = 3/143 (2%)
 Frame = +1

Query: 94  ASEASILSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLS 273
           A+ A+ LS+ E SL+R +W Q K        +L+   KA+P+    F +FA      L  
Sbjct: 12  AAVAAPLSADEASLVRGSWAQVKHS---EVDILYYIFKANPDIMAKFPQFAGKDLETLKG 68

Query: 274 NGNFLAQAYTILAGLNVVIQSL---SSQELMANQLNALGGAHKPRGATPVMFEQFGGILE 444
            G F   A  I+  ++ ++  +   ++   M   +  +   HK RG     F +F   L 
Sbjct: 69  TGQFATHAGRIVGFVSEIVALMGNSANMPAMETLIKDMAANHKARGIPKAQFNEFRASLV 128

Query: 445 EVLAEELGSGFTAEARQAWKNGL 513
             L  ++    +  A  AW  GL
Sbjct: 129 SYLQSKVSWNDSLGA--AWTQGL 149



>spu:HBB_GYMAC Hemoglobin beta chain.>sp:HBB_GYMAC Hemoglobin beta
           chain.>pir:S20271 hemoglobin beta chain - Antarctic
           dragonfish (Gymnodraco acuticeps)>prf:1803184B    
           hemoglobin:SUBUNIT=beta - Gymnodraco acuticeps
          Length = 146

 Score = 49.3 bits (116), Expect = 4e-05
 Identities = 33/124 (26%), Positives = 61/124 (48%), Gaps = 1/124 (0%)
 Frame = +1

Query: 172 DVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLAQAYTILAGLNVVIQSLSSQ 348
           D+ P+ L R +  +P  Q+ FS F N+  A  ++ N         +L GL++ ++ + + 
Sbjct: 22  DIGPKALSRCLIVYPWTQRYFSGFGNLYNAAAIIGNAKVAEHGIKVLHGLDLGLKKMDNI 81

Query: 349 ELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELGSGFTAEARQAWKNGLAALVA 528
           E     L++L    +     P  F+     +  VLA +LGS FTAE +  ++  L A+++
Sbjct: 82  EAAYADLSSLHS--EKLHVDPDNFKLLSDCITIVLAAKLGSAFTAETQATFQKFLGAVMS 139

Query: 529 GISK 540
            + K
Sbjct: 140 ALGK 143



>prf:2221402A      myoglobin - Aphrodita aculeata>gp:AAU46754_1
           [U46754] gi:1491803  nerve myoglobin [Aphrodite
           aculeata]
          Length = 151

 Score = 49.3 bits (116), Expect = 4e-05
 Identities = 37/134 (27%), Positives = 55/134 (40%), Gaps = 4/134 (2%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQAKKDG---DVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGN 282
           LS  + ++IR TW + +  G   D+   +  +F +  P  Q  F        A L +N  
Sbjct: 4   LSGADIAVIRSTWAKVQGSGSATDIGRSIFIKFFELDPAAQNEFP-CKGESLAALKTNVL 62

Query: 283 FLAQAYTILAGLNVVIQSLSSQELMAN-QLNALGGAHKPRGATPVMFEQFGGILEEVLAE 459
                   +  +   +  L      A+  L  LG  HK RG TP  F + G  L  +LA 
Sbjct: 63  LGQHGAKFMEYITTAVNGLDDYAGKAHGPLTELGSRHKTRGTTPANFGKAGEALLAILAS 122

Query: 460 ELGSGFTAEARQAW 501
            +G  FT  A+ AW
Sbjct: 123 VVGGDFTPAAKDAW 136



>gp:AF528160_1 [AF528160] gi:22135546  beta globin [Ctenopharyngodon
           idella]
          Length = 147

 Score = 49.3 bits (116), Expect = 4e-05
 Identities = 35/141 (24%), Positives = 67/141 (46%), Gaps = 2/141 (1%)
 Frame = +1

Query: 124 ERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQ-AELLSNGNFLAQAY 300
           ER+ I   W +   D ++ PQ L R +  +P  Q+ F+ F N+   A ++ N    A   
Sbjct: 7   ERTAILGLWGKLNID-EIGPQALSRCLIVYPWTQRYFATFGNLSSPAAIIGNPKVAAHGK 65

Query: 301 TILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELG-SGF 477
           T++ GL   I++L + +   + L+ +    +     P  F      +    A + G SGF
Sbjct: 66  TVMGGLERAIKNLDNIKATYSALSVMHS--EKLHVDPDNFRLLADCITVCAAMKFGPSGF 123

Query: 478 TAEARQAWKNGLAALVAGISK 540
            A+ ++AW+  L+ +V+ + +
Sbjct: 124 NADVQEAWQKFLSVVVSALCR 144



>prf:2420495C      hemoglobin:SUBUNIT=beta - Gymnodraco
           acuticeps>gp:AF067568_1 [AF067568] gi:3372853
           hemoglobin beta chain [Gymnodraco acuticeps]
          Length = 147

 Score = 49.3 bits (116), Expect = 4e-05
 Identities = 33/124 (26%), Positives = 61/124 (48%), Gaps = 1/124 (0%)
 Frame = +1

Query: 172 DVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLAQAYTILAGLNVVIQSLSSQ 348
           D+ P+ L R +  +P  Q+ FS F N+  A  ++ N         +L GL++ ++ + + 
Sbjct: 23  DIGPKALSRCLIVYPWTQRYFSGFGNLYNAAAIIGNAKVAEHGIKVLHGLDLGLKKMDNI 82

Query: 349 ELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELGSGFTAEARQAWKNGLAALVA 528
           E     L++L    +     P  F+     +  VLA +LGS FTAE +  ++  L A+++
Sbjct: 83  EAAYADLSSLHS--EKLHVDPDNFKLLSDCITIVLAAKLGSAFTAETQATFQKFLGAVMS 140

Query: 529 GISK 540
            + K
Sbjct: 141 ALGK 144



>gp:D88116_1 [D88116] gi:1644253  beta-globin [Cyprinus carpio]
          Length = 148

 Score = 48.9 bits (115), Expect = 5e-05
 Identities = 35/141 (24%), Positives = 66/141 (45%), Gaps = 2/141 (1%)
 Frame = +1

Query: 124 ERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQ-AELLSNGNFLAQAY 300
           ERS I   W +   D ++ PQ L R +  +P  Q+ F+ F N+   A ++ N    A   
Sbjct: 8   ERSAIIGLWGKLNPD-ELGPQALARCLIVYPWTQRYFASFGNLSSPAAIMGNPKVAAHGR 66

Query: 301 TILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELG-SGF 477
           T++ GL   I+++ + +     L+ +    +     P  F      +   +A + G SGF
Sbjct: 67  TVMGGLERAIKNMDNIKATYAPLSVMHS--EKLHVDPDNFRLLADCITVCVAMKFGPSGF 124

Query: 478 TAEARQAWKNGLAALVAGISK 540
            A+ ++AW+  L  +V+ + +
Sbjct: 125 NADVQEAWQKFLCVVVSALCR 145



>prf:1922037A      myoglobin - Caretta caretta (loggerhead)
          Length = 153

 Score = 48.9 bits (115), Expect = 5e-05
 Identities = 38/137 (27%), Positives = 67/137 (48%), Gaps = 3/137 (2%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQAKKDGDVAPQ-VLFRFVKAHPEYQKMFSKFANVPQAELL-SNGNF 285
           LS  E + +   W + + D     Q V+ R  + HPE Q+ F+KF N+   + L S+   
Sbjct: 2   LSDDEWNHVLGIWAKVEPDLSANGQEVIIRLFQLHPETQERFAKFKNLTTIDALKSSEEV 61

Query: 286 LAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQF-GGILEEVLAEE 462
                T+L  L  +++  ++ E    +L  L  +H  +   PV + +F   I+ +V+AE+
Sbjct: 62  KKHGTTVLTALGRILKQKNNNE---QELKPLAESHATKHKIPVKYLEFICEIIVKVIAEK 118

Query: 463 LGSGFTAEARQAWKNGL 513
             S F A+++ A K  L
Sbjct: 119 HPSDFGADSQAAMKKAL 135



>spu:MYG_CARCR Myoglobin.>sp:MYG_CARCR Myoglobin.
          Length = 153

 Score = 48.9 bits (115), Expect = 5e-05
 Identities = 38/137 (27%), Positives = 67/137 (48%), Gaps = 3/137 (2%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQAKKDGDVAPQ-VLFRFVKAHPEYQKMFSKFANVPQAELL-SNGNF 285
           LS  E + +   W + + D     Q V+ R  + HPE Q+ F+KF N+   + L S+   
Sbjct: 2   LSDDEWNHVLGIWAKVEPDLSAHGQEVIIRLFQLHPETQERFAKFKNLTTIDALKSSEEV 61

Query: 286 LAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQF-GGILEEVLAEE 462
                T+L  L  +++  ++ E    +L  L  +H  +   PV + +F   I+ +V+AE+
Sbjct: 62  KKHGTTVLTALGRILKQKNNHE---QELKPLAESHATKHKIPVKYLEFICEIIVKVIAEK 118

Query: 463 LGSGFTAEARQAWKNGL 513
             S F A+++ A K  L
Sbjct: 119 HPSDFGADSQAAMKKAL 135



>pir:HBPT hemoglobin beta chain - potoroo (tentative sequence)
          Length = 146

 Score = 48.9 bits (115), Expect = 5e-05
 Identities = 41/147 (27%), Positives = 67/147 (44%), Gaps = 2/147 (1%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFL 288
           LSS E+ LI   W +   +     + L R +  +P   + F  F ++  A+ +L N   L
Sbjct: 3   LSSEEKGLITSLWGKIDIE-QTGGEALGRLLIVYPWTSRFFDHFGDLSSAKAVLGNAKVL 61

Query: 289 AQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEEL 465
           A    +L      I++L + +    +L+ L   H  +    P  F+  G +L   LAE  
Sbjct: 62  AHGAKVLVSFGDAIKNLDNLKGTFAKLSEL---HCDKLHVDPENFKLLGNVLVICLAEHF 118

Query: 466 GSGFTAEARQAWKNGLAALVAGISKNL 546
           G  FT +A+ AW+     LVAG++  L
Sbjct: 119 GKDFTIDAQVAWQK----LVAGVANAL 141



>spu:HBB_POTTR Hemoglobin beta chain.>sp:HBB_POTTR Hemoglobin beta
           chain.>prf:711676A      globin beta - Potorous
           tridactylus (long-nosed rat kangaroo)
          Length = 146

 Score = 48.9 bits (115), Expect = 5e-05
 Identities = 41/147 (27%), Positives = 67/147 (44%), Gaps = 2/147 (1%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFL 288
           LSS E+ LI   W +   +     + L R +  +P   + F  F ++  A+ +L N   L
Sbjct: 3   LSSEEKGLITSLWGKIDIE-QTGGEALGRLLIVYPWTSRFFDHFGDLSSAKAVLGNAKVL 61

Query: 289 AQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEEL 465
           A    +L      I++L + +    +L+ L   H  +    P  F+  G +L   LAE  
Sbjct: 62  AHGAKVLVSFGDAIKNLDNLKGTFAKLSEL---HCDKLHVDPENFKLLGNVLVICLAEHF 118

Query: 466 GSGFTAEARQAWKNGLAALVAGISKNL 546
           G  FT +A+ AW+     LVAG++  L
Sbjct: 119 GKDFTIDAQVAWQK----LVAGVANAL 141



>spu:HBB_STROE Hemoglobin beta chain.>pir:S55248 hemoglobin beta
           chain - Ryukyu rufous turtle dove>prf:2019265B    
           hemoglobin:SUBUNIT=beta - Streptopelia orientalis
          Length = 146

 Score = 48.9 bits (115), Expect = 5e-05
 Identities = 37/131 (28%), Positives = 57/131 (43%), Gaps = 1/131 (0%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLS-NGNFLA 291
           S+ E+ LI   W +     D   + L R +  +P  Q+ F+ F N+  A  +S N N  A
Sbjct: 4   SAEEKQLITSIWGKVNV-ADCGAEALARLLIVYPWTQRFFASFGNLSSATAISGNPNVKA 62

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELGS 471
               +L      +++L + +    QL+ L          P  F+  G IL  VLA   G 
Sbjct: 63  HGKKVLTSFGDAVKNLDNIKGTFAQLSELHC--NKLHVDPENFKLLGDILVIVLAAHFGK 120

Query: 472 GFTAEARQAWK 504
            FT E + AW+
Sbjct: 121 DFTPECQAAWQ 131



>pir:MYTTG myoglobin - green seaturtle (tentative sequence)
          Length = 153

 Score = 48.5 bits (114), Expect = 7e-05
 Identities = 38/137 (27%), Positives = 67/137 (48%), Gaps = 3/137 (2%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQAKKDGDVAPQ-VLFRFVKAHPEYQKMFSKFANVPQAELL-SNGNF 285
           LS  E + +   W + + D     Q V+ R  + HPE Q+ F+KF N+   + L S+   
Sbjct: 2   LSDDEWNHVLGIWAKVEPDLTAHGQEVIIRLFQLHPETQERFAKFKNLTTIDALKSSEEV 61

Query: 286 LAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQF-GGILEEVLAEE 462
                T+L  L  +++  ++ E    +L  L  +H  +   PV + +F   I+ +V+AE+
Sbjct: 62  KKHGTTVLTALGRILKQKNNHE---QELKPLAESHATKHKIPVKYLEFICEIIVKVIAEK 118

Query: 463 LGSGFTAEARQAWKNGL 513
             S F A+++ A K  L
Sbjct: 119 HPSDFGADSQAAMKKAL 135



>spu:MYG_CHEMY Myoglobin.>sp:MYG_CHEMY Myoglobin.>prf:0902173A    
           myoglobin - Chelonia mydas caranigra
          Length = 153

 Score = 48.5 bits (114), Expect = 7e-05
 Identities = 38/137 (27%), Positives = 67/137 (48%), Gaps = 3/137 (2%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQAKKDGDVAPQ-VLFRFVKAHPEYQKMFSKFANVPQAELL-SNGNF 285
           LS  E + +   W + + D     Q V+ R  + HPE Q+ F+KF N+   + L S+   
Sbjct: 2   LSDDEWNHVLGIWAKVEPDLTAHGQEVIIRLFQLHPETQERFAKFKNLTTIDALKSSEEV 61

Query: 286 LAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQF-GGILEEVLAEE 462
                T+L  L  +++  ++ E    +L  L  +H  +   PV + +F   I+ +V+AE+
Sbjct: 62  KKHGTTVLTALGRILKQKNNHE---QELKPLAESHATKHKIPVKYLEFICEIIVKVIAEK 118

Query: 463 LGSGFTAEARQAWKNGL 513
             S F A+++ A K  L
Sbjct: 119 HPSDFGADSQAAMKKAL 135



>spu:HBG2_HYLLA Hemoglobin gamma-2 chain.
          Length = 146

 Score = 48.5 bits (114), Expect = 7e-05
 Identities = 36/143 (25%), Positives = 63/143 (43%), Gaps = 2/143 (1%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLA 291
           +  +++ I   W +   + DV  + L R +  +P  Q+ F  F N+  A  ++ N    A
Sbjct: 4   TEEDKATITSLWGKVNVE-DVGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKA 62

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
               +L  L   I++L   +    QL+ L   H  +    P  F   G +L  VLA   G
Sbjct: 63  HGKKVLTSLGGAIKNLDDLKGTFAQLSEL---HCDKLHVDPENFRLLGNVLVTVLAIHFG 119

Query: 469 SGFTAEARQAWKNGLAALVAGIS 537
             FT E + +W+  +A + + +S
Sbjct: 120 KEFTPEVQASWQKMVAGVASALS 142



>gp:AF528200_1 [AF528200] gi:22135560  beta globin [Misgurnus
           anguillicaudatus]
          Length = 147

 Score = 48.5 bits (114), Expect = 7e-05
 Identities = 37/141 (26%), Positives = 68/141 (47%), Gaps = 2/141 (1%)
 Frame = +1

Query: 124 ERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQ-AELLSNGNFLAQAY 300
           ERS I   W +   D ++ PQ L R +  +P  Q+ F+ F N+   A ++ N    A   
Sbjct: 7   ERSAIIGLWGKLNPD-ELGPQALARCLIVYPWTQRYFASFGNLSSPAAIMDNPKVAAHGR 65

Query: 301 TILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELG-SGF 477
           T++ GL   I+++ + +     L+ +  + K R   P  F      +    A + G SGF
Sbjct: 66  TVMGGLERAIKNMDNIKATYAPLSVMH-SEKLR-VDPDNFRLLADYITVCAAMKFGPSGF 123

Query: 478 TAEARQAWKNGLAALVAGISK 540
           +A  ++AW+  L+ +V+ + +
Sbjct: 124 SANVQEAWQKFLSVVVSALCR 144



>gp:RNEP2GL_1 [X56327] gi:4539553  epsilon 2 globin [Rattus
           norvegicus]
          Length = 147

 Score = 48.5 bits (114), Expect = 7e-05
 Identities = 34/143 (23%), Positives = 67/143 (46%), Gaps = 2/143 (1%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLA 291
           ++ E++ I   W++   +  +  + L R +  +P  Q+ F KF N+  A  ++ N    A
Sbjct: 5   TAEEKAAIISIWEKVDLE-KLGGETLGRLLIVYPWTQRFFDKFGNLSSAPAIMGNPQIRA 63

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
               +L  L + ++++ + +     L+ L   H  +    P  F+  G +L  VL+   G
Sbjct: 64  HGKKVLVSLGLAVENMDNLKETFAHLSEL---HCDKLHVDPENFKLLGNVLVIVLSSYFG 120

Query: 469 SGFTAEARQAWKNGLAALVAGIS 537
             FTAE + AW+  +A +   +S
Sbjct: 121 KEFTAEVQAAWQKLVAGVATALS 143



>pir:I37036 hemoglobin gamma-2 chain - common gibbon>gp:GIBHBGGL_2
           [J05174] gi:177011  Gibbon gamma-1 and gamma-2 globin
           genes, complete cds. [Hylobates lar]
          Length = 147

 Score = 48.5 bits (114), Expect = 7e-05
 Identities = 36/143 (25%), Positives = 63/143 (43%), Gaps = 2/143 (1%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLA 291
           +  +++ I   W +   + DV  + L R +  +P  Q+ F  F N+  A  ++ N    A
Sbjct: 5   TEEDKATITSLWGKVNVE-DVGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKA 63

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
               +L  L   I++L   +    QL+ L   H  +    P  F   G +L  VLA   G
Sbjct: 64  HGKKVLTSLGGAIKNLDDLKGTFAQLSEL---HCDKLHVDPENFRLLGNVLVTVLAIHFG 120

Query: 469 SGFTAEARQAWKNGLAALVAGIS 537
             FT E + +W+  +A + + +S
Sbjct: 121 KEFTPEVQASWQKMVAGVASALS 143



>spu:HBB_CARAU Hemoglobin beta chain.>sp:HBB_CARAU Hemoglobin beta
           chain.>pir:HBGY hemoglobin beta chain -
           goldfish>prf:0606173B      hemoglobin beta - Carassius
           auratus (goldfish)
          Length = 147

 Score = 48.1 bits (113), Expect = 9e-05
 Identities = 35/141 (24%), Positives = 66/141 (45%), Gaps = 2/141 (1%)
 Frame = +1

Query: 124 ERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQ-AELLSNGNFLAQAY 300
           ERS I   W +   D ++ PQ L R +  +P  Q+ F+ F N+   A ++ N    A   
Sbjct: 7   ERSAIIGLWGKLNPD-ELGPQALARCLIVYPWTQRYFATFGNLSSPAAIMGNPKVAAHGR 65

Query: 301 TILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELG-SGF 477
           T++ GL   I+++ + +     L+ +    +     P  F      +    A + G SGF
Sbjct: 66  TVMGGLERAIKNMDNIKATYAPLSVMHS--EKLHVDPDNFRLLADCITVCAAMKFGPSGF 123

Query: 478 TAEARQAWKNGLAALVAGISK 540
            A+ ++AW+  L+ +V+ + +
Sbjct: 124 NADVQEAWQKFLSVVVSALCR 144



>gp:AB004740_1 [AB004740] gi:2208895  beta-globin [Cyprinus carpio]
          Length = 148

 Score = 48.1 bits (113), Expect = 9e-05
 Identities = 35/141 (24%), Positives = 65/141 (45%), Gaps = 2/141 (1%)
 Frame = +1

Query: 124 ERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQ-AELLSNGNFLAQAY 300
           ERS I   W +   D ++ PQ L R +  +P  Q+ F+ F N+   A ++ N    A   
Sbjct: 8   ERSAIIGLWGKLNPD-ELGPQALARCLIVYPWTQRYFASFGNLSSPAAIMGNPKVAAHGR 66

Query: 301 TILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELG-SGF 477
           T++ GL   I+++ + +     L+ +    +     P  F      +    A + G SGF
Sbjct: 67  TVMGGLERAIKNMDNIKATYAPLSVMHS--EKLHVDPDNFRLLADCITVCAAMKFGPSGF 124

Query: 478 TAEARQAWKNGLAALVAGISK 540
            A+ ++AW+  L  +V+ + +
Sbjct: 125 NADVQEAWQKFLCVVVSALCR 145



>spu:HBF1_URECA Hemoglobin F-I.>sp:HBF1_URECA Hemoglobin
           F-I.>prf:1301290A      hemoglobin - Urechis caupo
          Length = 141

 Score = 48.1 bits (113), Expect = 9e-05
 Identities = 35/119 (29%), Positives = 55/119 (45%)
 Frame = +1

Query: 178 APQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQAYTILAGLNVVIQSLSSQELM 357
           A  + F+++ A+P     F KF++VP   L SN  + AQ  T++  L+ V+ +L      
Sbjct: 26  ADSIFFKYLTAYPGDLAFFHKFSSVPLYGLRSNPAYKAQTLTVINYLDKVVDALGGN--A 83

Query: 358 ANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELGSGFTAEARQAWKNGLAALVAGI 534
              + A   +H   G TP  F Q   ++  V  EE  +  T  A  AW +    LVA +
Sbjct: 84  GALMKAKVPSHDAMGITPKHFGQLLKLVGGVFQEEFSADPTTVA--AWGDAAGVLVAAM 140



>pir:A25537 globin F-I - spoonworm (Urechis caupo)>gp:UUNHBFI_1
           [J02624] gi:162545  Urechis caupo F-I hemoglobin mRNA,
           complete cds. [Urechis caupo]
          Length = 142

 Score = 48.1 bits (113), Expect = 9e-05
 Identities = 35/119 (29%), Positives = 55/119 (45%)
 Frame = +1

Query: 178 APQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQAYTILAGLNVVIQSLSSQELM 357
           A  + F+++ A+P     F KF++VP   L SN  + AQ  T++  L+ V+ +L      
Sbjct: 27  ADSIFFKYLTAYPGDLAFFHKFSSVPLYGLRSNPAYKAQTLTVINYLDKVVDALGGN--A 84

Query: 358 ANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELGSGFTAEARQAWKNGLAALVAGI 534
              + A   +H   G TP  F Q   ++  V  EE  +  T  A  AW +    LVA +
Sbjct: 85  GALMKAKVPSHDAMGITPKHFGQLLKLVGGVFQEEFSADPTTVA--AWGDAAGVLVAAM 141



>spu:MYG_GOBGI Myoglobin.>sp:MYG_GOBGI Myoglobin.
          Length = 146

 Score = 47.8 bits (112), Expect = 1e-04
 Identities = 34/142 (23%), Positives = 66/142 (45%), Gaps = 2/142 (1%)
 Frame = +1

Query: 133 LIRKTWDQAKKDGDV-APQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQAYTIL 309
           ++ K W   + D       VL R    HPE  K+F KFA +   +L  +    A   T+L
Sbjct: 5   MVLKCWGPVEADYTTHGSLVLTRLFTEHPETLKLFPKFAGIAHGDLAGDAGVSAHGATVL 64

Query: 310 AGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVM-FEQFGGILEEVLAEELGSGFTAE 486
             L  ++++  +    A  L  L  +H  +   P++ F+    ++ +V+ E+  +G  A 
Sbjct: 65  NKLGDLLKARGAH---AALLKPLSSSHATKHKIPIINFKLIAEVIGKVMEEK--AGLDAA 119

Query: 487 ARQAWKNGLAALVAGISKNLKK 552
            + A +N +A ++A +  + K+
Sbjct: 120 GQTALRNVMAVIIADMEADYKE 141



>spu:MYG_PSEGE Myoglobin.>sp:MYG_PSEGE Myoglobin.
          Length = 146

 Score = 47.8 bits (112), Expect = 1e-04
 Identities = 34/142 (23%), Positives = 65/142 (44%), Gaps = 2/142 (1%)
 Frame = +1

Query: 133 LIRKTWDQAKKD-GDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQAYTIL 309
           ++ K W   + D       VL R    HPE  K+F KFA +   +L  +    A   T+L
Sbjct: 5   MVLKCWGLVEADYATYGSLVLTRLFTEHPETLKLFPKFAGIAHGDLAGDAGVSAHGATVL 64

Query: 310 AGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVM-FEQFGGILEEVLAEELGSGFTAE 486
             L  ++++       A  L  L  +H  +   P++ F+    ++ +V+ E+  +G  A 
Sbjct: 65  NKLGDLLKARGGH---AALLKPLSSSHATKHKIPIINFKLIAEVIGKVMEEK--AGLDAA 119

Query: 487 ARQAWKNGLAALVAGISKNLKK 552
            + A +N +A ++A +  + K+
Sbjct: 120 GQTALRNVMAVIIADMEADYKE 141



>gp:PGU71055_1 [U71055] gi:10312067  myoglobin [Pseudochaenichthys
           georgianus]
          Length = 147

 Score = 47.8 bits (112), Expect = 1e-04
 Identities = 34/142 (23%), Positives = 65/142 (44%), Gaps = 2/142 (1%)
 Frame = +1

Query: 133 LIRKTWDQAKKD-GDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQAYTIL 309
           ++ K W   + D       VL R    HPE  K+F KFA +   +L  +    A   T+L
Sbjct: 6   MVLKCWGLVEADYATYGSLVLTRLFTEHPETLKLFPKFAGIAHGDLAGDAGVSAHGATVL 65

Query: 310 AGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVM-FEQFGGILEEVLAEELGSGFTAE 486
             L  ++++       A  L  L  +H  +   P++ F+    ++ +V+ E+  +G  A 
Sbjct: 66  NKLGDLLKARGGH---AALLKPLSSSHATKHKIPIINFKLIAEVIGKVMEEK--AGLDAA 120

Query: 487 ARQAWKNGLAALVAGISKNLKK 552
            + A +N +A ++A +  + K+
Sbjct: 121 GQTALRNVMAVIIADMEADYKE 142



>gp:GGU71057_1 [U71057] gi:10312071  myoglobin [Gobionotothen
           gibberifrons]
          Length = 147

 Score = 47.8 bits (112), Expect = 1e-04
 Identities = 34/142 (23%), Positives = 66/142 (45%), Gaps = 2/142 (1%)
 Frame = +1

Query: 133 LIRKTWDQAKKDGDV-APQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQAYTIL 309
           ++ K W   + D       VL R    HPE  K+F KFA +   +L  +    A   T+L
Sbjct: 6   MVLKCWGPVEADYTTHGSLVLTRLFTEHPETLKLFPKFAGIAHGDLAGDAGVSAHGATVL 65

Query: 310 AGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVM-FEQFGGILEEVLAEELGSGFTAE 486
             L  ++++  +    A  L  L  +H  +   P++ F+    ++ +V+ E+  +G  A 
Sbjct: 66  NKLGDLLKARGAH---AALLKPLSSSHATKHKIPIINFKLIAEVIGKVMEEK--AGLDAA 120

Query: 487 ARQAWKNGLAALVAGISKNLKK 552
            + A +N +A ++A +  + K+
Sbjct: 121 GQTALRNVMAVIIADMEADYKE 142



>gp:AF361744_1 [AF361744] gi:19880109  hemoglobin [Yoldia eightsi]
          Length = 147

 Score = 47.8 bits (112), Expect = 1e-04
 Identities = 34/143 (23%), Positives = 59/143 (40%), Gaps = 1/143 (0%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFV-KAHPEYQKMFSKFANVPQAELLSNGNFLA 291
           S+ +   +R  W     D D A   +F  + + +P+YQ  F  F  +  + L  N N   
Sbjct: 4   SAAQVDTVRSNWCSMTADIDAAGYRIFELLFQRNPDYQSKFKAFKGLAVSALKGNPNAEK 63

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELGS 471
               +L GL  ++ +L++ EL       +   HKPRG     F+  G  +   L+E    
Sbjct: 64  HIRIVLGGLGRILGALNTPELDVIY-KEMASNHKPRGVMKQQFKDMGQAIVTALSEIQSK 122

Query: 472 GFTAEARQAWKNGLAALVAGISK 540
              +  R  W+    ++  GI +
Sbjct: 123 SGGSFDRATWEALFESVANGIGQ 145



>prf:0511279A      hemoglobin CTTVI - Chironomus thummi thummi
          Length = 147

 Score = 47.8 bits (112), Expect = 1e-04
 Identities = 34/135 (25%), Positives = 57/135 (42%), Gaps = 3/135 (2%)
 Frame = +1

Query: 106 SILSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNF 285
           ++L++ +  L++KTW   K +      +L+   KA+P+    F +FA      +  +  F
Sbjct: 1   AVLTTEQADLVKKTWSTVKFN---EVDILYAVFKAYPDIMAKFPQFAGKDLDSIKDSAAF 57

Query: 286 LAQAYTILAGLNVVIQSLSSQE---LMANQLNALGGAHKPRGATPVMFEQFGGILEEVLA 456
              A  I++ L+ VI    S      + N    L  +HKPRG +   F +F   L   L 
Sbjct: 58  ATHATRIVSFLSEVISLAGSDANIPAIQNLAKELATSHKPRGVSKDQFTEFRTALFTYLK 117

Query: 457 EELGSGFTAEARQAW 501
             +   F      AW
Sbjct: 118 AHI--NFDGPTETAW 130



>pir:GGICE6 globin CTT-VI - midge (Chironomus thummi thummi)
           (tentative sequence)
          Length = 147

 Score = 47.8 bits (112), Expect = 1e-04
 Identities = 34/135 (25%), Positives = 57/135 (42%), Gaps = 3/135 (2%)
 Frame = +1

Query: 106 SILSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNF 285
           ++L++ +  L++KTW   K +      +L+   KA+P+    F +FA      +  +  F
Sbjct: 1   AVLTTEQADLVKKTWSTVKFN---EVDILYAVFKAYPDIMAKFPQFAGKDLDSIKDSAAF 57

Query: 286 LAQAYTILAGLNVVIQSLSSQE---LMANQLNALGGAHKPRGATPVMFEQFGGILEEVLA 456
              A  I++ L+ VI    S      + N    L  +HKPRG +   F +F   L   L 
Sbjct: 58  ATHATRIVSFLSEVISLAGSDANIPAIQNLAKELATSHKPRGVSKDQFTEFRTALFTYLK 117

Query: 457 EELGSGFTAEARQAW 501
             +   F      AW
Sbjct: 118 AHI--NFDGPTETAW 130



>pir:GGICE2 globin CTT-II beta - midge (Chironomus thummi
           thummi)>prf:765051A      hemoglobin CTTIIbeta -
           Chironomus thummi thummi
          Length = 145

 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 35/137 (25%), Positives = 57/137 (41%), Gaps = 3/137 (2%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLA 291
           LS+ E SL+R +W Q K        +L+   KA+P+    F +FA      L   G F  
Sbjct: 3   LSADEASLVRGSWAQVKHS---EVDILYYIFKANPDIMAKFPQFAGKDLETLKGTGQFAT 59

Query: 292 QAYTILAGLNVVIQSL---SSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEE 462
            A  I+  ++ ++  +   ++   M   +  +   HK RG     F +F   L   L  +
Sbjct: 60  HAGRIVGFVSEIVALMGNSANMPAMETLIKDMAANHKARGIPKAQFNEFRASLVSYLQSK 119

Query: 463 LGSGFTAEARQAWKNGL 513
           +    +  A  AW  GL
Sbjct: 120 VSWNDSLGA--AWTQGL 134



>prf:2403307A      globin:SUBUNIT=beta - Oncorhynchus mykiss
           (rainbow trout)>gp:DNMGG_1 [D82926] gi:1183021
           beta-globin [Oncorhynchus mykiss]
          Length = 148

 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 38/142 (26%), Positives = 66/142 (45%), Gaps = 3/142 (2%)
 Frame = +1

Query: 124 ERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANV-PQAELLSNGNFLAQAY 300
           ERS I   W +   D ++ PQ L R +   P  Q+ FS F N+   A ++ N        
Sbjct: 8   ERSAIVGLWGKISVD-EIGPQALARLLIVSPWTQRHFSTFGNLSTPAAIMGNPAVAKHGK 66

Query: 301 TILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELGSG- 474
           T++ GL+  +Q+L     + N   AL   H  +    P  F      +   +A +LG   
Sbjct: 67  TVMHGLDRAVQNLDD---IKNTYTALSVMHSEKLHVDPDNFRLLADCITVCVAAKLGPAV 123

Query: 475 FTAEARQAWKNGLAALVAGISK 540
           F+A+ ++A++  LA +V+ + +
Sbjct: 124 FSADTQEAFQKFLAVVVSALGR 145



>spu:HBB_APUAP Hemoglobin beta chain.>sp:HBB_APUAP Hemoglobin beta
           chain.>pir:HBSI hemoglobin beta chain -
           swift>prf:1601314B      hemoglobin beta - Apus apus
           (swift)
          Length = 146

 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 38/144 (26%), Positives = 63/144 (43%), Gaps = 2/144 (1%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLA 291
           ++ E+ LI   W +     D   + L R +  +P  Q+ F+ F N+  A  ++ N    A
Sbjct: 4   TAEEKQLITGLWGKVNV-ADCGAEALARLLIVYPWTQRFFASFGNLSSATAVIGNPMVRA 62

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
               +L      +++L S +    QL+ L   H  +    P  F   G IL  VLA    
Sbjct: 63  HGKKVLTSFGEAVKNLDSIKSTFAQLSEL---HCDKLHVDPENFRLLGDILIIVLAAHFS 119

Query: 469 SGFTAEARQAWKNGLAALVAGISK 540
             FT EA+QAW   + A+   +++
Sbjct: 120 KDFTPEAQQAWAKLVRAVAHALAR 143



>spu:HBB_PSIKR Hemoglobin beta chain.>sp:HBB_PSIKR Hemoglobin beta
           chain.>pir:A34947 hemoglobin beta chain - rose-ringed
           parakeet>prf:1603336A      hemoglobin beta - Psittacula
           krameri (rose-ringed parakeet)
          Length = 146

 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 37/144 (25%), Positives = 64/144 (43%), Gaps = 2/144 (1%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLA 291
           S+ E+ LI   W +     +   + L R +  +P  Q+ F+ F N+  A  +L N N  A
Sbjct: 4   SAEEKQLITGLWGKVNV-AECGAEALARLLIVYPWTQRFFTSFGNLSSASAVLGNPNVRA 62

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
               +L      +++L + +    QL+ L   H  +    P  F   G IL  VLA   G
Sbjct: 63  HGKKVLTSFGEAVKNLDNIKNTFAQLSEL---HCDKLHVDPENFRLLGDILIIVLAGHFG 119

Query: 469 SGFTAEARQAWKNGLAALVAGISK 540
             FT + + AW+  + A+   +++
Sbjct: 120 KDFTPDCQAAWQKLVRAVAHALAR 143



>spu:HBB2_CYGMA Hemoglobin beta-2 chain.>sp:HBB2_CYGMA Hemoglobin
           beta-2 chain.>pir:S16371 hemoglobin beta-II chain -
           Antarctic dragonfish (Cygnodraco mawsoni)>prf:1715172C  
              hemoglobin:SUBUNIT=beta:ISOTYPE=2 - Cygnodraco
           mawsoni
          Length = 146

 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 38/144 (26%), Positives = 71/144 (48%), Gaps = 2/144 (1%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQ 294
           ++ ER+ I+  + + + D  V P  L R +  +P  Q+ F KF N+  A  ++    +++
Sbjct: 4   TNFERATIKDIFSKLEYDV-VGPATLARCLVVYPWTQRYFGKFGNLYNAAAIAENAMVSK 62

Query: 295 -AYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
              TI+ GL+   Q++ + + + N    L   H  +    P  F+     L  VLA +LG
Sbjct: 63  HGTTIIHGLD---QAVKNMDDIKNTYAELSVLHCDKLHVDPDNFQLLAECLTIVLAAQLG 119

Query: 469 SGFTAEARQAWKNGLAALVAGISK 540
             FT E + A++  +A +V+ + K
Sbjct: 120 KEFTGEVQAAFQKFMAVVVSSLGK 143



>prf:1312301E      globin E - Chironomus thummi thummi
          Length = 151

 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 37/133 (27%), Positives = 54/133 (39%)
 Frame = +1

Query: 103 ASILSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGN 282
           AS LS  +  L++ T+ + K D   +  +L+   KA P  Q  F +F       +     
Sbjct: 12  ASALSGDQIGLVQSTYGKVKGD---SVGILYAVFKADPTIQAAFPQFVGKDLDAIKGGAE 68

Query: 283 FLAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEE 462
           F   A  I+  L  VI  L +   +   ++AL   HKPRG T   F  F       L   
Sbjct: 69  FSTHAGRIVGFLGGVIDDLPN---IGKHVDALVATHKPRGVTHAQFNNFRAAFIAYLKGH 125

Query: 463 LGSGFTAEARQAW 501
           +   +TA    AW
Sbjct: 126 V--DYTAAVEAAW 136



>spu:GLBX_CHITH Globin CTT-X.>sp:GLBX_CHITH Globin CTT-X.>pir:GGICEX
           globin CTT-X - midge (Chironomus thummi thummi)
          Length = 151

 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 31/109 (28%), Positives = 45/109 (40%), Gaps = 3/109 (2%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLA 291
           L +HE   ++ TW     D     ++L+   KAHP+    F KFA      +    +F  
Sbjct: 7   LDAHEVEQVQATWKAVSHD---EVEILYTVFKAHPDIMAKFPKFAGKDLEAIKDTADFAV 63

Query: 292 QAYTILAGLNVVIQSLSS---QELMANQLNALGGAHKPRGATPVMFEQF 429
            A  I+      +  L S   Q  +   L+ LG  HK RG T   F +F
Sbjct: 64  HASRIIGFFGEYVTLLGSSGNQAAIRTLLHDLGVFHKTRGITKAQFGEF 112



>prf:2415425L      globin:ISOTYPE=Cpa E - Chironomus
           pallidivittatus>gp:CPGGCE_6 [Y10623] gi:1805728  globin
           Cpa E gene product [Chironomus pallidivittatus]
          Length = 152

 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 37/133 (27%), Positives = 56/133 (41%)
 Frame = +1

Query: 103 ASILSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGN 282
           AS LS+ + SL++ T+ + K D   +  +L+   KA    Q  F +F       +     
Sbjct: 13  ASALSADQISLVQSTYGKVKGD---STGILYAVFKADSSIQAAFPQFVGKDLDAIKGGAE 69

Query: 283 FLAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEE 462
           F   A  I+  L+ VI  L +   +   ++AL   HKPRG T   F  F       L   
Sbjct: 70  FATHAGRIVGFLSGVIDDLPN---IGKHVDALVATHKPRGVTHAQFNNFRAAFIGYLKGH 126

Query: 463 LGSGFTAEARQAW 501
           +   +TA    AW
Sbjct: 127 V--DYTAAVEAAW 137



>sp:GLBP_CHITH Globin CTT-E/E' precursor.>prf:2415425E    
           globin:ISOTYPE=Ctt E - Chironomus thummi
           thummi>gp:CHIHBA5_1 [M17604] gi:156566  C.thummi thummi
           globin gene E encoding hemoglobin, complete cds.
           [Chironomus thummi]>gp:CHIHBB5_1 [M17695] gi:156577
           C.thummi thummi globin gene E' encoding hemoglobin,
           complete cds. [Chironomus thummi]>gp:CTTCE1_5 [Y10622]
           gi:1805737  globin Ctt E gene product [Chironomus
           thummi]
          Length = 152

 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 37/133 (27%), Positives = 54/133 (39%)
 Frame = +1

Query: 103 ASILSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGN 282
           AS LS  +  L++ T+ + K D   +  +L+   KA P  Q  F +F       +     
Sbjct: 13  ASALSGDQIGLVQSTYGKVKGD---SVGILYAVFKADPTIQAAFPQFVGKDLDAIKGGAE 69

Query: 283 FLAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEE 462
           F   A  I+  L  VI  L +   +   ++AL   HKPRG T   F  F       L   
Sbjct: 70  FSTHAGRIVGFLGGVIDDLPN---IGKHVDALVATHKPRGVTHAQFNNFRAAFIAYLKGH 126

Query: 463 LGSGFTAEARQAW 501
           +   +TA    AW
Sbjct: 127 V--DYTAAVEAAW 137



>gp:AF528161_1 [AF528161] gi:22135548  beta globin [Cyprinus carpio]
          Length = 147

 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 36/144 (25%), Positives = 69/144 (47%), Gaps = 2/144 (1%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQ-AELLSNGNFLA 291
           +  +RS I   W +   D ++ PQ L R +  +P  Q+ F+ F N+   A ++ N    A
Sbjct: 4   TDEDRSAIIGLWGKLNPD-ELGPQALARCLIVYPWTQRYFASFGNLSSPAAIMDNPKVAA 62

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELG- 468
              T++ GL   I+++ + +     L+ +  + K R   P  F      +    A + G 
Sbjct: 63  HGRTVMGGLERAIKNMDNIKATYAPLSVMH-SEKLR-LDPDNFRLLADCITVCAAMKFGP 120

Query: 469 SGFTAEARQAWKNGLAALVAGISK 540
           SGF+A  ++AW+  L+ +V+ + +
Sbjct: 121 SGFSANVQEAWQKFLSVVVSALCR 144



>gp:AF528158_1 [AF528158] gi:22135542  beta globin [Paramisgurnus
           dabryanus]
          Length = 147

 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 37/142 (26%), Positives = 66/142 (46%), Gaps = 3/142 (2%)
 Frame = +1

Query: 124 ERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQ-AELLSNGNFLAQAY 300
           ER  I   W +   D ++ PQ L R +  +P  Q+ F+ F N+   A ++ N    A   
Sbjct: 7   ERHSITGVWGKISVD-EIGPQALARCLIVYPWTQRYFAAFGNLSSAAAIMGNPKVSAHGK 65

Query: 301 TILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG-SG 474
            ++ GL   I++L +   + +   AL   H  +    P  F   G  +   +A +LG S 
Sbjct: 66  VVMGGLERAIKNLDN---IKDTYAALSIMHSEKLHVDPDNFRLLGDCITVCVAMKLGPSV 122

Query: 475 FTAEARQAWKNGLAALVAGISK 540
           FT +  +AW+  L+ +V+ + +
Sbjct: 123 FTPDVHEAWQKFLSVVVSALCR 144



>gp:AF291835_1 [AF291835] gi:9930594  myoglobin [Scomber japonicus]
          Length = 147

 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 35/141 (24%), Positives = 64/141 (44%), Gaps = 2/141 (1%)
 Frame = +1

Query: 136 IRKTWDQAKKDGD-VAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQAYTILA 312
           + K W   + D D +   VL R    HP+ QK+F KFA +   ++  N    A   T+L 
Sbjct: 7   VLKFWGPVEADYDKIGNMVLTRLFTEHPDTQKLFPKFAGIGLGDMAGNAAISAHGATVLK 66

Query: 313 GLNVVIQSLSSQELMANQLNALGGAHKPRGATPV-MFEQFGGILEEVLAEELGSGFTAEA 489
            L  V+++  +    A  +  L  +H  +    +  F+    I+ +V+ E+  +G  A  
Sbjct: 67  KLAEVLKAKGNH---AGIIKPLANSHATKHKIAINNFKLITEIIVKVMQEK--AGLDAGG 121

Query: 490 RQAWKNGLAALVAGISKNLKK 552
           + A +N +   +A +  N K+
Sbjct: 122 QTALRNVMGVFIADMDANYKE 142



>gp:AK012495_1 [AK012495] gi:12849279  Mus musculus 11 days embryo
           whole body cDNA, RIKEN full-length enriched library,
           clone:2700067E08 product:hemoglobin Z, beta-like
           embryonic chain, full insert sequence. [Mus
           musculus]>gpu:AK012495_1 [AK012495] gi:12849279  Mus
           musculus 11 days embryo whole body cDNA, RIKEN
           full-length enriched library, clone:2700067E08
           product:hemoglobin Z, beta-like embryonic chain, full
           insert sequence. [Mus musculus]
          Length = 147

 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 37/146 (25%), Positives = 67/146 (45%), Gaps = 2/146 (1%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQA-ELLSNGNFLA 291
           ++ E++ I   WD+   +  V  + L R +  +P  Q+ F KF N+  A  ++ N    A
Sbjct: 5   TAEEKAAITSIWDKVDLE-KVGGETLGRLLIVYPWTQRFFDKFGNLSSALAIMGNPRIRA 63

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
               +L  L + ++++ + +     L+ L   H  +    P  F+  G +L  VL+    
Sbjct: 64  HGKKVLTSLGLGVKNMDNLKETFAHLSEL---HCDKLHVDPENFKLLGNMLVIVLSTHFA 120

Query: 469 SGFTAEARQAWKNGLAALVAGISKNL 546
            GFT E + AW+     LV G++  L
Sbjct: 121 KGFTPEVQAAWQK----LVIGVANAL 142



>gp:AK011619_1 [AK011619] gi:12847862  Mus musculus 10 days embryo
           whole body cDNA, RIKEN full-length enriched library,
           clone:2610029M02 product:hemoglobin Y, beta-like
           embryonic chain, full insert sequence. [Mus
           musculus]>gpu:AK011619_1 [AK011619] gi:12847862  Mus
           musculus 10 days embryo whole body cDNA, RIKEN
           full-length enriched library, clone:2610029M02
           product:hemoglobin Y, beta-like embryonic chain, full
           insert sequence. [Mus musculus]
          Length = 147

 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 35/139 (25%), Positives = 62/139 (44%), Gaps = 2/139 (1%)
 Frame = +1

Query: 127 RSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLAQAYT 303
           ++LI   W +   + +V  + L R +  +P   + F  F N+  A  ++ N    A    
Sbjct: 9   KTLINGLWSKVNVE-EVGGEALGRLLVVYPWTHRFFDSFGNLSSASAIMGNPRVKAHGKK 67

Query: 304 ILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELGSGFT 480
           +L      I++L +   + + L  L   H  +    P  F+  G +L  VLA   G+ FT
Sbjct: 68  VLTAFGESIKNLDN---LKSALAKLSELHCDKLHVDPENFKLLGNVLVIVLASHFGNEFT 124

Query: 481 AEARQAWKNGLAALVAGIS 537
           AE + AW+  +A +   +S
Sbjct: 125 AEMQAAWQKLVAGVATALS 143



>gp:NCU71058_1 [U71058] gi:10312073  myoglobin [Notothenia
           coriiceps]
          Length = 147

 Score = 47.0 bits (110), Expect = 2e-04
 Identities = 34/142 (23%), Positives = 66/142 (45%), Gaps = 2/142 (1%)
 Frame = +1

Query: 133 LIRKTWDQAKKD-GDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQAYTIL 309
           ++ K W   + D       VL R    HPE  K+F KFA +   +L  +    A   T+L
Sbjct: 6   MVLKCWGPMEADYATHGGLVLTRLFTEHPETLKLFPKFAGIAHGDLAGDAGVSAHGATVL 65

Query: 310 AGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVM-FEQFGGILEEVLAEELGSGFTAE 486
             L  ++++  +    A  L  L  +H  +   P++ F+    ++ +V+ E+  +G  A 
Sbjct: 66  NKLGDLLKARGAH---AALLKPLSSSHATKHKIPIINFKLIAEVIGKVMEEK--AGLDAA 120

Query: 487 ARQAWKNGLAALVAGISKNLKK 552
            + A +N +A ++A +  + K+
Sbjct: 121 GQTALRNVMAVIIADMEADYKE 142



>prf:2220343B      hemoglobin:SUBUNIT=beta - Decapterus maruadsi
          Length = 147

 Score = 47.0 bits (110), Expect = 2e-04
 Identities = 37/142 (26%), Positives = 65/142 (45%), Gaps = 3/142 (2%)
 Frame = +1

Query: 124 ERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANV-PQAELLSNGNFLAQAY 300
           ER+ I   W +    G++ PQ L R +  +P  Q+ FS F N+   A +L N    A   
Sbjct: 7   ERAAITSLWGKIDV-GEIGPQALARLLIVYPWTQRHFSTFGNLSTNAAILGNPKVAAHGK 65

Query: 301 TILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG-SG 474
           T++ GL + ++++ +   +      L   H  +    P  F     I    LA + G S 
Sbjct: 66  TVMGGLELAVKNMDN---IKGAYANLSKMHSEKIHVDPDNFRLLAEITTICLAAKFGPSV 122

Query: 475 FTAEARQAWKNGLAALVAGISK 540
           FT + ++AW+    A+V+ + +
Sbjct: 123 FTPDFQEAWQKFENAVVSALGR 144



>pir:I37035 hemoglobin gamma-1 chain - common gibbon>gp:GIBHBGGL_1
           [J05174] gi:177010  Gibbon gamma-1 and gamma-2 globin
           genes, complete cds. [Hylobates lar]
          Length = 147

 Score = 47.0 bits (110), Expect = 2e-04
 Identities = 35/143 (24%), Positives = 62/143 (42%), Gaps = 2/143 (1%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLA 291
           +  +++ I   W +   + D   + L R +  +P  Q+ F  F N+  A  ++ N    A
Sbjct: 5   TEEDKATITSLWGKVNVE-DAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKA 63

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
               +L  L   I++L   +    QL+ L   H  +    P  F   G +L  VLA   G
Sbjct: 64  HGKKVLTSLGGAIKNLDDLKGTFAQLSEL---HCDKLHVDPENFRLLGNVLVTVLAIHFG 120

Query: 469 SGFTAEARQAWKNGLAALVAGIS 537
             FT E + +W+  +A + + +S
Sbjct: 121 KEFTPEVQASWQKMVAGVASALS 143



>pir:HGMQR hemoglobin gamma-1 chain - rhesus macaque>gp:MACHBGA2_1
           [M19434] gi:342110  gamma-globin [Macaca mulatta]
          Length = 147

 Score = 47.0 bits (110), Expect = 2e-04
 Identities = 35/143 (24%), Positives = 62/143 (42%), Gaps = 2/143 (1%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLA 291
           +  +++ I   W +   + D   + L R +  +P  Q+ F  F N+  A  ++ N    A
Sbjct: 5   TEEDKATITSLWGKVNVE-DAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKA 63

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
               +L  L   I++L   +    QL+ L   H  +    P  F   G +L  VLA   G
Sbjct: 64  HGKKVLTSLGDAIKNLDDLKGTFAQLSEL---HCDKLHVDPENFRLLGNVLVTVLAIHFG 120

Query: 469 SGFTAEARQAWKNGLAALVAGIS 537
             FT E + +W+  +A + + +S
Sbjct: 121 KEFTPEVQASWQKMVAGVASALS 143



>sp:HBB_DECMA Hemoglobin beta chain.>gp:S83542_1 [S83542]
           gi:13241084  hemoglobin beta chain [Decapterus maruadsi]
          Length = 147

 Score = 47.0 bits (110), Expect = 2e-04
 Identities = 37/142 (26%), Positives = 65/142 (45%), Gaps = 3/142 (2%)
 Frame = +1

Query: 124 ERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANV-PQAELLSNGNFLAQAY 300
           ER+ I   W +    G++ PQ L R +  +P  Q+ FS F N+   A +L N    A   
Sbjct: 7   ERAAITSLWGKIDV-GEIGPQALARLLIVYPWTQRHFSTFGNLSTNAAILGNPKVAAHGK 65

Query: 301 TILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG-SG 474
           T++ GL + ++++ +   +      L   H  +    P  F     I    LA + G S 
Sbjct: 66  TVMGGLELAVKNMDN---IKGAYANLSKMHSEKIHVDPDNFRLLAEITTICLAAKFGPSV 122

Query: 475 FTAEARQAWKNGLAALVAGISK 540
           FT + ++AW+    A+V+ + +
Sbjct: 123 FTPDFQEAWQKFENAVVSALGR 144



>gp:D88117_1 [D88117] gi:1644255  beta-globin [Cyprinus carpio]
          Length = 148

 Score = 47.0 bits (110), Expect = 2e-04
 Identities = 34/141 (24%), Positives = 65/141 (45%), Gaps = 2/141 (1%)
 Frame = +1

Query: 124 ERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQ-AELLSNGNFLAQAY 300
           ERS I   W +   D ++ PQ L R +  +P  Q+ F+ F N+   A ++ N    A   
Sbjct: 8   ERSAIIGLWGKLNPD-ELGPQALARCLIVYPWTQRYFASFGNLSSPAAIMGNPKVAAHGR 66

Query: 301 TILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELG-SGF 477
           T++ GL   I+++ + +     L+ +    +     P  F      +   +A + G SGF
Sbjct: 67  TVMGGLERAIKNMDNIKATYAPLSVMHS--EKLHVDPDNFRLLADCITVCVAMKFGPSGF 124

Query: 478 TAEARQAWKNGLAALVAGISK 540
             + ++AW+  L  +V+ + +
Sbjct: 125 NPDVQEAWQKFLCVVVSALCR 145



>gp:AF291837_1 [AF291837] gi:9930598  myoglobin [Katsuwonus pelamis]
          Length = 146

 Score = 47.0 bits (110), Expect = 2e-04
 Identities = 38/141 (26%), Positives = 64/141 (44%), Gaps = 2/141 (1%)
 Frame = +1

Query: 136 IRKTWDQAKKD-GDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQAYTILA 312
           + K W   + D   V   VL R  K HPE QK+F KFA +   ++  N    A   T+L 
Sbjct: 7   VLKCWGAVEADFNTVGGLVLARLFKDHPETQKLFPKFAGI-TGDIAGNAAVAAHGATVLK 65

Query: 313 GLNVVIQSLSSQELMANQLNALGGAHKPRGATPV-MFEQFGGILEEVLAEELGSGFTAEA 489
            L  ++++  +    A  +  L  +H  +   P+  F+     L  VL E+  +G  A  
Sbjct: 66  KLGELLKAKGNH---AAIIKPLANSHAKQHKIPINNFKLITEALAHVLHEK--AGLDAAG 120

Query: 490 RQAWKNGLAALVAGISKNLKK 552
           + A +N +  ++A +  N K+
Sbjct: 121 QTALRNVMGIVIADLEANYKE 141



>spu:HBG_MACMU Hemoglobin gamma chain.>sp:HBG_MACMU Hemoglobin gamma
           chain.>pir:HGMQJ hemoglobin gamma chain - Japanese
           macaque>pir:HGBAY hemoglobin gamma chain - yellow
           baboon>prf:0611197A      hemoglobin gamma - Macaca
           mulatta (rhesus macaque)>prf:1208300A      hemoglobin
           gamma - Macaca fuscata (Japanese macaque)
          Length = 146

 Score = 47.0 bits (110), Expect = 2e-04
 Identities = 35/143 (24%), Positives = 62/143 (42%), Gaps = 2/143 (1%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLA 291
           +  +++ I   W +   + D   + L R +  +P  Q+ F  F N+  A  ++ N    A
Sbjct: 4   TEEDKATITSLWGKVNVE-DAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKA 62

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
               +L  L   I++L   +    QL+ L   H  +    P  F   G +L  VLA   G
Sbjct: 63  HGKKVLTSLGDAIKNLDDLKGTFAQLSEL---HCDKLHVDPENFRLLGNVLVTVLAIHFG 119

Query: 469 SGFTAEARQAWKNGLAALVAGIS 537
             FT E + +W+  +A + + +S
Sbjct: 120 KEFTPEVQASWQKMVAGVASALS 142



>spu:HBG1_HYLLA Hemoglobin gamma-1 chain.>sp:HBG_HYLLA Hemoglobin
           gamma-1 and gamma-2 chains.
          Length = 146

 Score = 47.0 bits (110), Expect = 2e-04
 Identities = 35/143 (24%), Positives = 62/143 (42%), Gaps = 2/143 (1%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLA 291
           +  +++ I   W +   + D   + L R +  +P  Q+ F  F N+  A  ++ N    A
Sbjct: 4   TEEDKATITSLWGKVNVE-DAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKA 62

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
               +L  L   I++L   +    QL+ L   H  +    P  F   G +L  VLA   G
Sbjct: 63  HGKKVLTSLGGAIKNLDDLKGTFAQLSEL---HCDKLHVDPENFRLLGNVLVTVLAIHFG 119

Query: 469 SGFTAEARQAWKNGLAALVAGIS 537
             FT E + +W+  +A + + +S
Sbjct: 120 KEFTPEVQASWQKMVAGVASALS 142



>spu:HBG_MACNE Hemoglobin gamma chain.>sp:HBG_MACNE Hemoglobin gamma
           chain.>pir:HGMQP hemoglobin gamma chain - pig-tailed
           macaque>prf:0503179A      hemoglobin gamma - Macaca sp.
          Length = 146

 Score = 47.0 bits (110), Expect = 2e-04
 Identities = 35/143 (24%), Positives = 62/143 (42%), Gaps = 2/143 (1%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLA 291
           +  +++ I   W +   + D   + L R +  +P  Q+ F  F N+  A  ++ N    A
Sbjct: 4   TEEDKATITSLWGKVNVE-DAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKA 62

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
               +L  L   I++L   +    QL+ L   H  +    P  F   G +L  VLA   G
Sbjct: 63  HGKKVLTSLGDAIKNLDDLKGTFAQLSEL---HCDKLHVDPENFRLLGNVLVTVLAIRFG 119

Query: 469 SGFTAEARQAWKNGLAALVAGIS 537
             FT E + +W+  +A + + +S
Sbjct: 120 KEFTPEVQASWQKMVAGVASALS 142



>spu:MYG_NOTCO Myoglobin.>sp:MYG_NOTCO Myoglobin.
          Length = 146

 Score = 47.0 bits (110), Expect = 2e-04
 Identities = 34/142 (23%), Positives = 66/142 (45%), Gaps = 2/142 (1%)
 Frame = +1

Query: 133 LIRKTWDQAKKD-GDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQAYTIL 309
           ++ K W   + D       VL R    HPE  K+F KFA +   +L  +    A   T+L
Sbjct: 5   MVLKCWGPMEADYATHGGLVLTRLFTEHPETLKLFPKFAGIAHGDLAGDAGVSAHGATVL 64

Query: 310 AGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVM-FEQFGGILEEVLAEELGSGFTAE 486
             L  ++++  +    A  L  L  +H  +   P++ F+    ++ +V+ E+  +G  A 
Sbjct: 65  NKLGDLLKARGAH---AALLKPLSSSHATKHKIPIINFKLIAEVIGKVMEEK--AGLDAA 119

Query: 487 ARQAWKNGLAALVAGISKNLKK 552
            + A +N +A ++A +  + K+
Sbjct: 120 GQTALRNVMAVIIADMEADYKE 141



>pir:GGGACR globin - horn shell (Cerithidea rhizophorarum)
           (tentative sequence)
          Length = 151

 Score = 47.0 bits (110), Expect = 2e-04
 Identities = 35/141 (24%), Positives = 56/141 (38%), Gaps = 4/141 (2%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQAKKDGDVAPQ---VLFRFV-KAHPEYQKMFSKFANVPQAELLSNG 279
           L    +S +  +W    KD          LF  + K  P+ +  F+ F N+  AE+ + G
Sbjct: 2   LQPASKSALASSWKTLAKDAATIQNNGATLFSLLFKQFPDTRNYFTHFGNMSDAEMKTTG 61

Query: 280 NFLAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAE 459
              A +  + AG+  +I S+   + M      L   H  R      F +   +    L E
Sbjct: 62  VGKAHSMAVFAGIGSMIDSMDDADCMNGLALKLSRNHIQRKIGASRFGEMRQVFPNFLDE 121

Query: 460 ELGSGFTAEARQAWKNGLAAL 522
            LG G + + + AW   LA L
Sbjct: 122 ALGGGASGDVKGAWDALLAYL 142



>spu:GLB_CERRH Globin (Myoglobin).>sp:GLB_CERRH Globin
           (Myoglobin).>prf:0907165A      myoglobin,dimeric -
           Cerithidea rhizophorarum
          Length = 151

 Score = 47.0 bits (110), Expect = 2e-04
 Identities = 35/141 (24%), Positives = 56/141 (38%), Gaps = 4/141 (2%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQAKKDGDVAPQ---VLFRFV-KAHPEYQKMFSKFANVPQAELLSNG 279
           L    +S +  +W    KD          LF  + K  P+ +  F+ F N+  AE+ + G
Sbjct: 2   LQPASKSALASSWKTLAKDAATIQNNGATLFSLLFKQFPDTRNYFTHFGNMSDAEMKTTG 61

Query: 280 NFLAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAE 459
              A +  + AG+  +I S+   + M      L   H  R      F +   +    L E
Sbjct: 62  VGKAHSMAVFAGIGSMIDSMDDADCMNGLALKLSRNHIQRKIGASRFGEMRQVFPNFLDE 121

Query: 460 ELGSGFTAEARQAWKNGLAAL 522
            LG G + + + AW   LA L
Sbjct: 122 ALGGGASGDVKGAWDALLAYL 142



>spu:MYG_GRAGE Myoglobin.>sp:MYG_GRAGE Myoglobin.>pir:MYTTM
           myoglobin - map turtle>prf:0706256A      myoglobin -
           Graptemys geographica (map turtle)
          Length = 153

 Score = 46.6 bits (109), Expect = 2e-04
 Identities = 38/137 (27%), Positives = 66/137 (47%), Gaps = 3/137 (2%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQAKKDGDVAPQ-VLFRFVKAHPEYQKMFSKFANVPQA-ELLSNGNF 285
           LS  E   +   W + + D     Q V+ R  + HPE Q+ F+KF N+    EL S+   
Sbjct: 2   LSDDEWHHVLGIWAKVEPDLSAHGQEVIIRLFQVHPETQERFAKFKNLKTIDELRSSEEV 61

Query: 286 LAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQF-GGILEEVLAEE 462
                T+L  L  +++  ++ E    +L  L  +H  +   PV + +F   I+ +V+AE+
Sbjct: 62  KKHGTTVLTALGRILKLKNNHE---PELKPLAESHATKHKIPVKYLEFICEIIVKVIAEK 118

Query: 463 LGSGFTAEARQAWKNGL 513
             S F A+++ A +  L
Sbjct: 119 HPSDFGADSQAAMRKAL 135



>pir:S41625 hemoglobin beta chain - Atlantic salmon>prf:2009340A    
            beta globin - Salmo salar (Atlantic
           salmon)>gp:SSGLOBINB_1 [X69958] gi:452795  beta globin
           [Salmo salar]
          Length = 148

 Score = 46.6 bits (109), Expect = 2e-04
 Identities = 38/142 (26%), Positives = 67/142 (46%), Gaps = 3/142 (2%)
 Frame = +1

Query: 124 ERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANV-PQAELLSNGNFLAQAY 300
           ERS I   W +   D ++ PQ L R +   P  Q+ FS F N+   A ++ N        
Sbjct: 8   ERSAIVGLWGKISVD-EIGPQALARLLIVSPWTQRHFSTFGNLSTPAAIMGNPAVAKHGK 66

Query: 301 TILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG-SG 474
           T++ GL+  +Q+L     + N   AL   H  +    P  F      +   +A +LG + 
Sbjct: 67  TVMHGLDRAVQNLDD---IKNAYTALSVMHSEKLHVDPDNFRLLADCITVCVAAKLGPTV 123

Query: 475 FTAEARQAWKNGLAALVAGISK 540
           F+A+ ++A++  LA +V+ + +
Sbjct: 124 FSADIQEAFQKFLAVVVSALGR 145



>spu:MYG_GALGA Myoglobin.>sp:MYG_GALGA Myoglobin.>prf:0710196A    
           myoglobin - Galeorhinus australis
          Length = 148

 Score = 46.6 bits (109), Expect = 2e-04
 Identities = 34/128 (26%), Positives = 54/128 (41%), Gaps = 1/128 (0%)
 Frame = +1

Query: 175 VAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQAYTILAGLNVVIQSLSSQEL 354
           V   +L R  + +PE Q  F K  N    EL    +  AQA T+L  L  +++   +   
Sbjct: 20  VGQNILLRLFEQYPESQSYFPKLKNKSLGELKDTADIKAQADTVLKALGNIVKKKGNH-- 77

Query: 355 MANQLNALGGAH-KPRGATPVMFEQFGGILEEVLAEELGSGFTAEARQAWKNGLAALVAG 531
            +  + AL   H       P  F +   I   VL+E   S   A+A++A+     ++ + 
Sbjct: 78  -SQPVKALAATHITTHKIPPHYFTKITTIAVGVLSEMYPSEMNAQAQEAFSGAFKSICSD 136

Query: 532 ISKNLKKA 555
           I K  K A
Sbjct: 137 IEKEYKAA 144



>pir:S14574 globin C precursor - midge (Chironomus
           tentans)>gp:CTORFHB_2 [X56272] gi:7092  ORF B gene
           product [Chironomus tentans]
          Length = 160

 Score = 46.6 bits (109), Expect = 2e-04
 Identities = 35/140 (25%), Positives = 59/140 (42%), Gaps = 3/140 (2%)
 Frame = +1

Query: 103 ASILSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGN 282
           A+ LS+ E SL+R +W+QAK        +L+   KA+P+    F +F       L     
Sbjct: 15  AAPLSADEASLVRASWNQAKHS---EVDILYYIFKANPDIMAKFPQFVGKDLDSLKDTAA 71

Query: 283 FLAQAYTILAGLNVVIQSL---SSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVL 453
           F   A  I+  ++ +I  +   +++  M   +N +   HK R      F +F   L   L
Sbjct: 72  FATHAGRIVGFMSQIIALMGNEANRPAMVTLINEMAANHKARKIPQAQFNEFRASLVSYL 131

Query: 454 AEELGSGFTAEARQAWKNGL 513
              +   +  +   AW  GL
Sbjct: 132 QSHV--TWNDKLGAAWTQGL 149



>gpu:BX572605_1 [BX572605] gi:39650628  possible hemoprotein
           [Rhodopseudomonas palustris CGA009]
          Length = 141

 Score = 46.6 bits (109), Expect = 2e-04
 Identities = 27/94 (28%), Positives = 42/94 (43%)
 Frame = +1

Query: 241 FANVPQAELLSNGNFLAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMF 420
           FA  P+   L +G+   Q   +++ LNVV+  L+    +      L   H   G +   +
Sbjct: 33  FATAPELRPLFHGDMRRQGKKLMSTLNVVVTGLTDLTTILPATGRLARLHVAYGVSAAHY 92

Query: 421 EQFGGILEEVLAEELGSGFTAEARQAWKNGLAAL 522
             FG  L   L  ELG+ +T E   AW++  A L
Sbjct: 93  TPFGAALLWTLERELGAEWTPELAAAWRDAYAML 126



>sp:HBG_RABIT Hemoglobin gamma chain (Beta-3).
          Length = 146

 Score = 46.6 bits (109), Expect = 2e-04
 Identities = 36/146 (24%), Positives = 63/146 (42%), Gaps = 2/146 (1%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLA 291
           ++ E++ I  TW     + D   + L R +  +P  Q+ F  F N+  +  ++ N    A
Sbjct: 4   TAEEKAAITSTWKLVDVE-DAGAEALGRLLVVYPWTQRFFDSFGNLSSSSAIMGNPKVKA 62

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
               +L      ++++     + N    L   H  R    P  F+  G +L  VLA+  G
Sbjct: 63  HGKKVLTAFGDAVKNVDD---LKNTFAHLSELHCDRLHVDPENFKLLGNVLVIVLAKYFG 119

Query: 469 SGFTAEARQAWKNGLAALVAGISKNL 546
             FT + + AW+     LVAG++  L
Sbjct: 120 KEFTPQVQSAWQK----LVAGVATAL 141



>spu:HBG_HUMAN Hemoglobin gamma-A and gamma-G chains.>spu:HBG1_PANTR
           Hemoglobin gamma-A chain (Hemoglobin
           gamma-1).>sp:HBG_HUMAN Hemoglobin gamma-A and gamma-G
           chains.>prf:711677A      hemoglobin gamma - Pan
           troglodytes (chimpanzee)
          Length = 146

 Score = 46.6 bits (109), Expect = 2e-04
 Identities = 35/143 (24%), Positives = 62/143 (42%), Gaps = 2/143 (1%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLA 291
           +  +++ I   W +   + D   + L R +  +P  Q+ F  F N+  A  ++ N    A
Sbjct: 4   TEEDKATITSLWGKVNVE-DAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKA 62

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
               +L  L   I+ L   +    QL+ L   H  +    P  F+  G +L  VLA   G
Sbjct: 63  HGKKVLTSLGDAIKHLDDLKGTFAQLSEL---HCDKLHVDPENFKLLGNVLVTVLAIHFG 119

Query: 469 SGFTAEARQAWKNGLAALVAGIS 537
             FT E + +W+  + A+ + +S
Sbjct: 120 KEFTPEVQASWQKMVTAVASALS 142



>pir:HBRB3 hemoglobin gamma chain - rabbit>prf:0712221A      globin
           beta3 - Oryctolagus cuniculus (domestic
           rabbit)>gp:OCBGLX_1 [V00883] gi:1494  beta-3 globin
           [Oryctolagus cuniculus]>gp:RABBGLOB_2 [M18818] gi:164792
            Rabbit beta-like globin gene cluster encoding the
           epsilon, gamma, delta (pseudogene) and beta globin
           polypeptides, complete cds. [Oryctolagus cuniculus]
          Length = 147

 Score = 46.6 bits (109), Expect = 2e-04
 Identities = 36/146 (24%), Positives = 63/146 (42%), Gaps = 2/146 (1%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLA 291
           ++ E++ I  TW     + D   + L R +  +P  Q+ F  F N+  +  ++ N    A
Sbjct: 5   TAEEKAAITSTWKLVDVE-DAGAEALGRLLVVYPWTQRFFDSFGNLSSSSAIMGNPKVKA 63

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
               +L      ++++     + N    L   H  R    P  F+  G +L  VLA+  G
Sbjct: 64  HGKKVLTAFGDAVKNVDD---LKNTFAHLSELHCDRLHVDPENFKLLGNVLVIVLAKYFG 120

Query: 469 SGFTAEARQAWKNGLAALVAGISKNL 546
             FT + + AW+     LVAG++  L
Sbjct: 121 KEFTPQVQSAWQK----LVAGVATAL 142



>pir:HGHUA hemoglobin gamma-A chain [validated] - human>pir:HGCZA
           hemoglobin gamma-A chain - chimpanzee>gp:AF130098_1
           [AF130098] gi:11493500  PRO2979 [Homo
           sapiens]>gp:BC020719_1 [BC020719] gi:18088861
           hemoglobin, gamma A [Homo sapiens]>gp:CHPGM12GLB_2
           [M92294] gi:176779  gamma-2 globin [Pan
           troglodytes]>gp:HSGGL2_1 [V00513] gi:31729  gamma globin
           [Homo sapiens]>gp:HUMGAMGLOA_2 [M91036] gi:182963
           A-gamma globin [Homo sapiens]>gp:HUMGAMGLOB_2 [M91037]
           gi:182966  A-gamma globin [Homo sapiens]>gp:HUMHBB_3
           [U01317] gi:455995  HBG1 gene product [Homo
           sapiens]>gp:PTAGGLOG_1 [X03110] gi:38163  A-gamma-globin
           [Pan troglodytes]>gpu:BC020719_1 [BC020719] gi:18088861 
           A-gamma globin [Homo sapiens]
          Length = 147

 Score = 46.6 bits (109), Expect = 2e-04
 Identities = 35/143 (24%), Positives = 62/143 (42%), Gaps = 2/143 (1%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLA 291
           +  +++ I   W +   + D   + L R +  +P  Q+ F  F N+  A  ++ N    A
Sbjct: 5   TEEDKATITSLWGKVNVE-DAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKA 63

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
               +L  L   I+ L   +    QL+ L   H  +    P  F+  G +L  VLA   G
Sbjct: 64  HGKKVLTSLGDAIKHLDDLKGTFAQLSEL---HCDKLHVDPENFKLLGNVLVTVLAIHFG 120

Query: 469 SGFTAEARQAWKNGLAALVAGIS 537
             FT E + +W+  + A+ + +S
Sbjct: 121 KEFTPEVQASWQKMVTAVASALS 143



>sp:HBB_SALSA Hemoglobin beta chain.
          Length = 147

 Score = 46.6 bits (109), Expect = 2e-04
 Identities = 38/142 (26%), Positives = 67/142 (46%), Gaps = 3/142 (2%)
 Frame = +1

Query: 124 ERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANV-PQAELLSNGNFLAQAY 300
           ERS I   W +   D ++ PQ L R +   P  Q+ FS F N+   A ++ N        
Sbjct: 7   ERSAIVGLWGKISVD-EIGPQALARLLIVSPWTQRHFSTFGNLSTPAAIMGNPAVAKHGK 65

Query: 301 TILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG-SG 474
           T++ GL+  +Q+L     + N   AL   H  +    P  F      +   +A +LG + 
Sbjct: 66  TVMHGLDRAVQNLDD---IKNAYTALSVMHSEKLHVDPDNFRLLADCITVCVAAKLGPTV 122

Query: 475 FTAEARQAWKNGLAALVAGISK 540
           F+A+ ++A++  LA +V+ + +
Sbjct: 123 FSADIQEAFQKFLAVVVSALGR 144



>gpu:AX888129_1 [AX888129] gi:40046982  Sequence 3992 from Patent
           EP1033401. [Homo sapiens]
          Length = 147

 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 35/143 (24%), Positives = 62/143 (42%), Gaps = 2/143 (1%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLA 291
           +  +++ I   W +   + D   + L R +  +P  Q+ F  F N+  A  ++ N    A
Sbjct: 5   TEEDKATITSLWGKVNVE-DAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKA 63

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
               +L  L   I+ L   +    QL+ L   H  +    P  F+  G +L  VLA   G
Sbjct: 64  HGKKVLTSLGDAIKHLDDLKGTFAQLSEL---HCDKLHVDPENFKLLGXVLVTVLAIHFG 120

Query: 469 SGFTAEARQAWKNGLAALVAGIS 537
             FT E + +W+  + A+ + +S
Sbjct: 121 KEFTPEVQASWQKMVTAVASALS 143



>gp:AY014769_1 [AY014769] gi:13124832  omega globin [Macropus
           eugenii]
          Length = 147

 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 39/146 (26%), Positives = 66/146 (44%), Gaps = 3/146 (2%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVA-PQVLFRFVKAHPEYQKMFSKFANVPQAELLS-NGNFL 288
           ++ E+ +I   W  AK D + A    L R +  +P  Q+ FS F N+     ++ N    
Sbjct: 5   TAEEKQIILAIW--AKIDIEEAGAAALSRLLVVYPWTQRYFSNFGNLSSPTAIAGNPRVR 62

Query: 289 AQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEEL 465
           A    +L      +++L + +   ++L+ L   H  +    P  F   G  L   LA  L
Sbjct: 63  AHGKKVLTSFGEAVKNLDNVKATFDKLSQL---HSDKLHVDPQNFSLLGDNLIIALAAAL 119

Query: 466 GSGFTAEARQAWKNGLAALVAGISKN 543
           G  FT EA+ AW+  +  + A +S+N
Sbjct: 120 GKDFTIEAQAAWQKLVGVVAAALSRN 145



>pir:I37002 hemoglobin gamma chain - pygmy chimpanzee>gp:CHPPHYGEN_1
           [M93716] gi:176889  Pan paniscus DNA fragment. [Pan
           paniscus]
          Length = 147

 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 35/143 (24%), Positives = 61/143 (42%), Gaps = 2/143 (1%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLA 291
           +  +++ I   W +   + D   + L R +  +P  Q+ F  F N+  A  ++ N    A
Sbjct: 5   TEEDKATITSLWGKVNVE-DAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKA 63

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
               +L  L   I+ L   +    QL+ L   H  +    P  F   G +L  VLA   G
Sbjct: 64  HGKKVLTSLGDAIKHLDDLKGTFAQLSEL---HCDKLHVDPENFRLLGNVLVTVLAIHFG 120

Query: 469 SGFTAEARQAWKNGLAALVAGIS 537
             FT E + +W+  + A+ + +S
Sbjct: 121 KEFTPEVQASWQKMVTAVASALS 143



>pir:HGMQR2 hemoglobin gamma-2 chain - rhesus macaque>gp:MACHBGA1_1
           [M19433] gi:342109  gamma-globin [Macaca
           mulatta]>gp:MMGGLINE_1 [X53419] gi:38088
           gamma-globin-2(A) [Macaca mulatta]
          Length = 147

 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 35/143 (24%), Positives = 62/143 (42%), Gaps = 2/143 (1%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLA 291
           +  +++ I   W +   + D   + L R +  +P  Q+ F  F N+  A  ++ N    A
Sbjct: 5   TEEDKATITSLWGKVNVE-DAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKA 63

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
               +L  L   I++L   +    QL+ L   H  +    P  F   G +L  VLA   G
Sbjct: 64  HGKKVLTSLGDAIKNLDDLKGTFAQLSEL---HCDKLHVDPENFRLLGNVLVTVLAIYFG 120

Query: 469 SGFTAEARQAWKNGLAALVAGIS 537
             FT E + +W+  +A + + +S
Sbjct: 121 KEFTPEVQASWQKMVAGVASALS 143



>pir:I37022 hemoglobin gamma-A chain - gorilla>gp:GGAGGLOG_1
           [X03112] gi:22862  A-gamma-globin [Gorilla
           gorilla]>gp:GORGM12GLB_2 [M92295] gi:177053  gamma-2
           globin [Gorilla gorilla]
          Length = 147

 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 35/143 (24%), Positives = 61/143 (42%), Gaps = 2/143 (1%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLA 291
           +  +++ I   W +   + D   + L R +  +P  Q+ F  F N+  A  ++ N    A
Sbjct: 5   TEEDKATITSLWGKVNVE-DAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKA 63

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
               +L  L   I+ L   +    QL+ L   H  +    P  F   G +L  VLA   G
Sbjct: 64  HGKKVLTSLGGAIKHLDDLKGTFAQLSEL---HCDKLHVDPENFRLLGNVLVTVLAIHFG 120

Query: 469 SGFTAEARQAWKNGLAALVAGIS 537
             FT E + +W+  + A+ + +S
Sbjct: 121 KEFTPEVQASWQKMVTAVASALS 143



>sp:HBB_ONCNE Hemoglobin beta chain.
          Length = 147

 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 38/142 (26%), Positives = 65/142 (45%), Gaps = 3/142 (2%)
 Frame = +1

Query: 124 ERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANV-PQAELLSNGNFLAQAY 300
           ERS I   W +   D ++ PQ L R +   P  Q+ FS F N+   A ++ N        
Sbjct: 7   ERSAIVGLWGKISVD-EIGPQALARLLIVSPWTQRHFSTFGNLSTPAAIMGNPAVAKHGK 65

Query: 301 TILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELGSG- 474
           T++ GL+  +Q+L     + N   AL   H  +    P  F      +   +A +LG   
Sbjct: 66  TVMHGLDRAVQNLDD---IKNTYAALSVMHSEKLHVDPDNFRLLADCITVCVAAKLGPAV 122

Query: 475 FTAEARQAWKNGLAALVAGISK 540
           F A+ ++A++  LA +V+ + +
Sbjct: 123 FNADTQEAFQKFLAVVVSALGR 144



>gpu:AY190698_1 [AY190698] gi:37779026  beta-globin [Pagrus major]
          Length = 148

 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 37/142 (26%), Positives = 60/142 (42%), Gaps = 3/142 (2%)
 Frame = +1

Query: 124 ERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANV-PQAELLSNGNFLAQAY 300
           ERS I+  W +     ++ PQ L R +  +P  Q+ FS F N+   A +L N        
Sbjct: 8   ERSAIKTLWGKINV-AEIGPQALTRLMIVYPWTQRHFSSFGNISTNAAILGNEKVAEHGR 66

Query: 301 TILAGLNVVIQSLSSQELMANQLNALGGAHKP-RGATPVMFEQFGGILEEVLAEELG-SG 474
           T++ GL+  +Q+L     + N    L   H       P  F          +  +LG   
Sbjct: 67  TVMGGLDRAVQNLDD---IKNAYTLLSQKHSEIIHVDPDNFRLLAECFSICVGIKLGPKV 123

Query: 475 FTAEARQAWKNGLAALVAGISK 540
           F A  ++AW+  LA +V  + +
Sbjct: 124 FNANVQEAWQKFLAVVVNALGR 145



>gp:D88115_1 [D88115] gi:1644251  beta-globin [Cyprinus
           carpio]>gp:D88118_1 [D88118] gi:1644257  beta-globin
           [Cyprinus carpio]>gp:D88120_1 [D88120] gi:1644261
           beta-globin [Cyprinus carpio]
          Length = 148

 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 34/141 (24%), Positives = 65/141 (45%), Gaps = 2/141 (1%)
 Frame = +1

Query: 124 ERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQ-AELLSNGNFLAQAY 300
           ERS I   W +   D ++ PQ L R +  +P  Q+ F+ F N+   A ++ N    A   
Sbjct: 8   ERSAIIGLWGKLNPD-ELGPQALARCLIVYPWTQRYFASFGNLSSPAAIMGNPKVAAHGR 66

Query: 301 TILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELG-SGF 477
           T++ GL   I+++ + +     L+ +    +     P  F      +    A + G SGF
Sbjct: 67  TVMGGLERAIKNMDNIKATYAPLSVMHS--EKLHVDPDNFRLLADCITVCAAMKFGPSGF 124

Query: 478 TAEARQAWKNGLAALVAGISK 540
           +   ++AW+  L+ +V+ + +
Sbjct: 125 SPNVQEAWQKFLSVVVSALCR 145



>gp:AY026061_1 [AY026061] gi:13124852  beta globin subunit
           [Oncorhynchus nerka]
          Length = 148

 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 38/142 (26%), Positives = 65/142 (45%), Gaps = 3/142 (2%)
 Frame = +1

Query: 124 ERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANV-PQAELLSNGNFLAQAY 300
           ERS I   W +   D ++ PQ L R +   P  Q+ FS F N+   A ++ N        
Sbjct: 8   ERSAIVGLWGKISVD-EIGPQALARLLIVSPWTQRHFSTFGNLSTPAAIMGNPAVAKHGK 66

Query: 301 TILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELGSG- 474
           T++ GL+  +Q+L     + N   AL   H  +    P  F      +   +A +LG   
Sbjct: 67  TVMHGLDRAVQNLDD---IKNTYAALSVMHSEKLHVDPDNFRLLADCITVCVAAKLGPAV 123

Query: 475 FTAEARQAWKNGLAALVAGISK 540
           F A+ ++A++  LA +V+ + +
Sbjct: 124 FNADTQEAFQKFLAVVVSALGR 145



>spu:HBB_CICCI Hemoglobin beta chain.>sp:HBB_CICCI Hemoglobin beta
           chain.>pir:HBKOW hemoglobin beta chain - white
           stork>prf:1010262B      hemoglobin beta - Ciconia
           ciconia (white stork)
          Length = 146

 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 36/133 (27%), Positives = 62/133 (46%), Gaps = 3/133 (2%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQ 294
           ++ E+ LI   W +   D +   + L R +  +P  Q+ F+ F N+  A  ++ GN +  
Sbjct: 4   TAEEKQLITGLWGKVNVD-ECGAEALARLLIVYPWTQRFFASFGNLATASAIT-GNAMVH 61

Query: 295 AY--TILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEEL 465
           A+   +L      +++L + +    QL+ L   H  +    P  F+  G IL  VLA   
Sbjct: 62  AHGKKVLTSFGEAVKNLDNIKNTFAQLSEL---HCDKLHVDPENFKLLGDILIIVLAAHF 118

Query: 466 GSGFTAEARQAWK 504
           G  FT + + AWK
Sbjct: 119 GKDFTPDCQAAWK 131



>spu:HBB_ALDEL Hemoglobin A and D beta chain.>sp:HBB_ALDEL
           Hemoglobin A and D beta chain.
          Length = 146

 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 35/130 (26%), Positives = 57/130 (42%), Gaps = 1/130 (0%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLA 291
           +S E+  I   W +    G+V  + L R +  +P  Q+ F+ F N+  A  +L N   LA
Sbjct: 4   TSEEKQYITSLWAKVNV-GEVGGEALARLLIVYPWTQRFFASFGNLSSANAILHNAKVLA 62

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELGS 471
               +L      +++L + +    QL+ L    +     P  F+  G IL  VLA     
Sbjct: 63  HGQKVLTSFGEAVKNLDNIKKTFAQLSEL--HCEKLHVDPENFKLLGNILIIVLATHFPK 120

Query: 472 GFTAEARQAW 501
            FT  ++ AW
Sbjct: 121 EFTPASQAAW 130



>spu:HBG_GORGO Hemoglobin gamma-A and gamma-G chains.>sp:HBG_GORGO
           Hemoglobin gamma-A and gamma-G chains.
          Length = 146

 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 35/143 (24%), Positives = 61/143 (42%), Gaps = 2/143 (1%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLA 291
           +  +++ I   W +   + D   + L R +  +P  Q+ F  F N+  A  ++ N    A
Sbjct: 4   TEEDKATITSLWGKVNVE-DAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKA 62

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
               +L  L   I+ L   +    QL+ L   H  +    P  F   G +L  VLA   G
Sbjct: 63  HGKKVLTSLGGAIKHLDDLKGTFAQLSEL---HCDKLHVDPENFRLLGNVLVTVLAIHFG 119

Query: 469 SGFTAEARQAWKNGLAALVAGIS 537
             FT E + +W+  + A+ + +S
Sbjct: 120 KEFTPEVQASWQKMVTAVASALS 142



>spu:MYG_CYPCA Myoglobin.>sp:MYG_CYPCA Myoglobin.>pir:MYCA myoglobin
           - common carp
          Length = 146

 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 37/146 (25%), Positives = 61/146 (41%), Gaps = 2/146 (1%)
 Frame = +1

Query: 121 HERSLIRKTWDQAKKDGD-VAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQA 297
           H+  L+ K W   + D +    +VL R  K HPE QK+F KF  +   EL  N    A  
Sbjct: 1   HDAELVLKCWGGVEADFEGTGGEVLTRLFKQHPETQKLFPKFVGIASNELAGNAAVKAHG 60

Query: 298 YTILAGLNVVIQSLSSQELMANQL-NALGGAHKPRGATPVMFEQFGGILEEVLAEELGSG 474
            T+L  L  ++++      +   L       HK        F     +L +V+AE+  +G
Sbjct: 61  ATVLKKLGELLKARGDHAAILKPLATTHANTHK---IALNNFRLITEVLVKVMAEK--AG 115

Query: 475 FTAEARQAWKNGLAALVAGISKNLKK 552
             A  + A +  +  ++  I    K+
Sbjct: 116 LDAGGQSALRRVMDVVIGDIDTYYKE 141



>spu:HBB0_PAGBO Hemoglobin beta-0 chain (HB 0).>sp:HBB0_PAGBO
           Hemoglobin beta-0 chain (HB 0).
          Length = 146

 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 35/140 (25%), Positives = 69/140 (49%), Gaps = 1/140 (0%)
 Frame = +1

Query: 124 ERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQ-AY 300
           ER+ I+  + + + D  V P  L R +  +P  Q+ F+KF N+  A  ++    +++   
Sbjct: 7   ERATIKDIFSKLEYDV-VGPATLARCLVVYPWTQRYFAKFGNLYTATAIAENAMVSKHGI 65

Query: 301 TILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELGSGFT 480
           TIL GL+  ++++   +    +L+ L    +     P  F+     L  V+A   GS FT
Sbjct: 66  TILHGLDRAVKNMDDIKNTYAELSVLHS--EKLHVDPDNFKLLADCLTIVVAARFGSAFT 123

Query: 481 AEARQAWKNGLAALVAGISK 540
            E + A++  +A +V+ + +
Sbjct: 124 GEVQAAFEKFMAVVVSSLGR 143



>spu:HBB_CERSI Hemoglobin beta chain.>sp:HBB_CERSI Hemoglobin beta
           chain.>pir:HBRNW hemoglobin beta chains - white
           rhinoceros>prf:0810212B      hemoglobin beta -
           Ceratotherium simum (white rhinoceros)
          Length = 146

 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 37/147 (25%), Positives = 66/147 (44%), Gaps = 2/147 (1%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANV-PQAELLSNGNFL 288
           L++ E++ +   WD+ K+D +V  + L R +  +P  Q+ F  F ++   A ++ N    
Sbjct: 3   LTAEEKAAVLALWDKVKED-EVGGEALGRLLVVYPWTQRFFDSFGDLSTPAAVMGNAKVK 61

Query: 289 AQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEEL 465
           A    +L      +  L +   +     AL   H  +    P  F   G +L  VLA+  
Sbjct: 62  AHGKKVLHSFGDGVHHLDN---LKGTFAALSELHCDKLHVDPENFRLLGNVLVVVLAKHF 118

Query: 466 GSGFTAEARQAWKNGLAALVAGISKNL 546
           G  FT E + A++     +VAG++  L
Sbjct: 119 GKQFTPELQAAYQK----VVAGVANAL 141



>sp:HBB1_XENLA Hemoglobin beta-1 chain (Major).>pir:HBXL hemoglobin
           beta chain, major - African clawed frog
          Length = 145

 Score = 45.8 bits (107), Expect = 4e-04
 Identities = 37/146 (25%), Positives = 65/146 (44%), Gaps = 3/146 (2%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQ--AKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGN 282
           L++H+R LI  TW +  AK  G    + L R +  +P  Q+ FS F N+  A+ +  N  
Sbjct: 2   LTAHDRQLINSTWGKLCAKTIGQ---EALGRLLWTYPWTQRYFSSFGNLNSADAVFHNEA 58

Query: 283 FLAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEE 462
             A    ++  +   I+ +   +    QL+      +     P+ F++FGG L   LA  
Sbjct: 59  VAAHGEKVVTSIGEAIKHMDDIKGYYAQLSKYHS--ETLHVDPLNFKRFGGCLSIALARH 116

Query: 463 LGSGFTAEARQAWKNGLAALVAGISK 540
               +T E   A+++   A+   + K
Sbjct: 117 FHEEYTPELHAAYEHLFDAIADALGK 142



>gp:SSABGLOB1_2 [X97284] gi:1431593  beta-globin [Salmo salar]
          Length = 148

 Score = 45.8 bits (107), Expect = 4e-04
 Identities = 37/142 (26%), Positives = 66/142 (46%), Gaps = 3/142 (2%)
 Frame = +1

Query: 124 ERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANV-PQAELLSNGNFLAQAY 300
           ERS I   W +   D ++ PQ L R +   P  Q+ FS F N+   A ++ N        
Sbjct: 8   ERSAIVGLWGKISVD-EIGPQALARLLIVSPWTQRHFSTFGNLSTPAAIMGNPAVAKHGK 66

Query: 301 TILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELGSG- 474
           T++ GL+  +Q+L     + N   AL   H  +    P  F      +   +A +LG   
Sbjct: 67  TVMHGLDRAVQNLDD---IKNAYTALSVMHSEKLHVDPDNFRLLADCITVCVAAKLGPAV 123

Query: 475 FTAEARQAWKNGLAALVAGISK 540
           F+A+ ++A++  L+ +V+ + +
Sbjct: 124 FSADIQEAFQKFLSVVVSALGR 145



>pir:T01069 hemoglobin beta chain - Kenyan clawed frog>prf:0908259A 
               globin beta - Xenopus laevis (African clawed
           frog)>gp:XELHBBC_1 [J00978] gi:214210  Xenopus laevis
           major beta-globin gene, complete cds. [Xenopus
           laevis]>gp:XLBGL2_1 [V01433] gi:64574  beta-globin
           [Xenopus borealis]
          Length = 146

 Score = 45.8 bits (107), Expect = 4e-04
 Identities = 37/146 (25%), Positives = 65/146 (44%), Gaps = 3/146 (2%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQ--AKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGN 282
           L++H+R LI  TW +  AK  G    + L R +  +P  Q+ FS F N+  A+ +  N  
Sbjct: 3   LTAHDRQLINSTWGKLCAKTIGQ---EALGRLLWTYPWTQRYFSSFGNLNSADAVFHNEA 59

Query: 283 FLAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEE 462
             A    ++  +   I+ +   +    QL+      +     P+ F++FGG L   LA  
Sbjct: 60  VAAHGEKVVTSIGEAIKHMDDIKGYYAQLSKYHS--ETLHVDPLNFKRFGGCLSIALARH 117

Query: 463 LGSGFTAEARQAWKNGLAALVAGISK 540
               +T E   A+++   A+   + K
Sbjct: 118 FHEEYTPELHAAYEHLFDAIADALGK 143



>spu:GLBT_CHITH Globin CTT-IIIA.>sp:GLBT_CHITH Globin
           CTT-IIIA.>pir:GGICEA globin CTT-IIIa - midge (Chironomus
           thummi thummi)>prf:0704271A      hemoglobin CTTIIIa -
           Chironomus thummi
          Length = 151

 Score = 45.8 bits (107), Expect = 4e-04
 Identities = 39/114 (34%), Positives = 52/114 (45%), Gaps = 1/114 (0%)
 Frame = +1

Query: 136 IRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQAYTILAG 315
           ++  W++ K  G    ++L+ F+   P    MF K  N   A       F  QA  I+A 
Sbjct: 17  VKGDWEKIKGSG---VEILYFFLNKFPGNFPMFKKLGN-DLAAAKGTAEFKDQADKIIAF 72

Query: 316 LNVVIQSLSSQELMANQL-NALGGAHKPRGATPVMFEQFGGILEEVLAEELGSG 474
           L  VI+ L S    A  L N LG +HK  G T   F+QF   L E+L   LG G
Sbjct: 73  LQGVIEKLGSDMGGAKALLNQLGTSHKAMGITKDQFDQFRQALTELLG-NLGFG 125



>spu:HBBA_ANGAN Hemoglobin anodic, beta chain.>sp:HBBA_ANGAN
           Hemoglobin anodic, beta chain.>prf:2318343B      anodic
           hemoglobin:SUBUNIT=beta - Anguilla anguilla (European
           eel)
          Length = 147

 Score = 45.8 bits (107), Expect = 4e-04
 Identities = 33/141 (23%), Positives = 70/141 (49%), Gaps = 2/141 (1%)
 Frame = +1

Query: 124 ERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQ-AY 300
           ER+ I+  W +   + ++ PQ + R +   P  Q+ F+ F N+  A  + N + +A+   
Sbjct: 7   ERTAIKSKWLKINIE-EIGPQAMRRLLIVCPWTQRHFANFGNLSTAAAIMNNDKVAKHGT 65

Query: 301 TILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELG-SGF 477
           T++ GL+  IQ++   +    QL+ +    +     P  F      +   +A + G + F
Sbjct: 66  TVMGGLDRAIQNMDDIKNAYRQLSVMHS--EKLHVDPDNFRLLAEHITLCMAAKFGPTEF 123

Query: 478 TAEARQAWKNGLAALVAGISK 540
           TA+ ++AW+  L A+ + +++
Sbjct: 124 TADVQEAWQKFLMAVTSALAR 144



>gp:AF528159_1 [AF528159] gi:22135544  beta globin [Carassius
           auratus]
          Length = 147

 Score = 45.4 bits (106), Expect = 6e-04
 Identities = 34/141 (24%), Positives = 64/141 (45%), Gaps = 2/141 (1%)
 Frame = +1

Query: 124 ERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQ-AELLSNGNFLAQAY 300
           ERS I   W +     ++ PQ L R +  +P  Q+ F+ F N+   A ++ N    A   
Sbjct: 7   ERSAIIGLWGKLNP-AELGPQALARCLIVYPWTQRYFATFGNLSSPAAIMGNPKVAAHGR 65

Query: 301 TILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELG-SGF 477
           T++ GL   I+++ + +     L+ +    +     P  F      +    A + G SGF
Sbjct: 66  TVMGGLERAIKNMDNIKATYAPLSVMHS--EKLHVDPDNFRLLADCITVCAAMKFGPSGF 123

Query: 478 TAEARQAWKNGLAALVAGISK 540
            A+ ++AW+  L  +V+ + +
Sbjct: 124 NADVQEAWQKFLCVVVSALCR 144



>gp:RNBHORA_1 [X60729] gi:1419183  beta-globin chain [Rattus
           norvegicus]
          Length = 147

 Score = 45.4 bits (106), Expect = 6e-04
 Identities = 33/143 (23%), Positives = 65/143 (45%), Gaps = 2/143 (1%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLA 291
           ++ E++     W++   +  +  + L R +  +P  Q+ F KF N+  A  ++ N    A
Sbjct: 5   TAEEKATSLSIWEKVDLE-KLGGETLGRLLIVYPWTQRFFDKFGNLSSAPAIMGNPQIRA 63

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
               +L  L + ++++ + +     L+ L   H  +    P  F+  G +L  VL    G
Sbjct: 64  HGKKVLVSLGLAVENMDNLKETFAHLSEL---HCDKLHVDPENFKLLGNVLVIVLFSYFG 120

Query: 469 SGFTAEARQAWKNGLAALVAGIS 537
             FTAE + AW+  +A +   +S
Sbjct: 121 KEFTAEVQAAWQKLVAGVATALS 143



>gp:TGLHBB_1 [L23800] gi:438907  beta-globin homolog [Tachyglossus
           aculeatus]
          Length = 147

 Score = 45.4 bits (106), Expect = 6e-04
 Identities = 36/147 (24%), Positives = 66/147 (44%), Gaps = 2/147 (1%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFL 288
           LS  E++ +   W     + ++  + L R +  +P  Q+ F  F ++  A+ ++ N    
Sbjct: 4   LSGSEKTAVTNLWGHVNVN-ELGGEALGRLLVVYPWTQRFFESFGDLSSADAVMGNAKVK 62

Query: 289 AQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEEL 465
           A    +L      +++L + +    +L+ L   H  +    P  F + G +L  VLA   
Sbjct: 63  AHGAKVLTSFGDALKNLDNLKGTFAKLSEL---HCDKLHVDPENFNRLGNVLVVVLARHF 119

Query: 466 GSGFTAEARQAWKNGLAALVAGISKNL 546
              FT EA+ AW+     LV+G+S  L
Sbjct: 120 SKEFTPEAQAAWQK----LVSGVSHAL 142



>prf:2311496A      myoglobin - Chionodraco
           rastrospinosus>gp:CRU70871_1 [U70871] gi:1809297
           myoglobin [Chionodraco rastrospinosus]>gp:CRU71059_1
           [U71059] gi:1809299  myoglobin [Chionodraco
           rastrospinosus]
          Length = 147

 Score = 45.4 bits (106), Expect = 6e-04
 Identities = 33/142 (23%), Positives = 65/142 (45%), Gaps = 2/142 (1%)
 Frame = +1

Query: 133 LIRKTWDQAKKDGDV-APQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQAYTIL 309
           ++ K W   + D       VL R    HPE  K+F KFA +   +L  +    A   T+L
Sbjct: 6   MVLKCWGPMEADHATHGSLVLTRLFTEHPETLKLFPKFAGIAHGDLAGDAGVSAHGATVL 65

Query: 310 AGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVM-FEQFGGILEEVLAEELGSGFTAE 486
             L  ++++  +    A  L  L  +H  +   P++ F+    ++ +V+ E+  +G  A 
Sbjct: 66  NKLGDLLKARGAH---AALLKPLSSSHATKHKIPIINFKLIAEVIGKVMEEK--AGLDAA 120

Query: 487 ARQAWKNGLAALVAGISKNLKK 552
            + A +N +A ++  +  + K+
Sbjct: 121 GQTALRNVMAIIITDMEADYKE 142



>prf:1603302A      gamma globin - Hylobates lar (common gibbon)
          Length = 147

 Score = 45.4 bits (106), Expect = 6e-04
 Identities = 34/143 (23%), Positives = 61/143 (41%), Gaps = 2/143 (1%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLA 291
           +  +++ I   W +   + D   + L R +  +P  Q+ F  F N+  A  ++ N    A
Sbjct: 5   TEEDKATITSLWGKVNVE-DAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKA 63

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
               +L  L   I++L   +    QL+ L   H  +    P  F   G +L  VLA   G
Sbjct: 64  HGKKVLTSLGGAIKNLDDLKGTFAQLSEL---HCDKLHVDPENFRLLGNVLVTVLAIHFG 120

Query: 469 SGFTAEARQAWKNGLAALVAGIS 537
             FT E + +W+  +  + + +S
Sbjct: 121 KEFTPEVQASWQKMVTGVASALS 143



>pir:A27800 hemoglobin gamma-1 chain - orangutan>gp:ORAGM12GLB_1
           [M92296] gi:342823  gamma-1 globin [Pongo
           pygmaeus]>gp:ORAHBG1F_1 [M16208] gi:342836  Orangutan
           gamma-1-fetal globin gene, complete cds. [Pongo
           pygmaeus]
          Length = 147

 Score = 45.4 bits (106), Expect = 6e-04
 Identities = 34/143 (23%), Positives = 61/143 (41%), Gaps = 2/143 (1%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLA 291
           +  +++ I   W +   + D   + L R +  +P  Q+ F  F N+  A  ++ N    A
Sbjct: 5   TEEDKATITSLWGKVNVE-DAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKA 63

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
               +L  L   I++L   +    QL+ L   H  +    P  F   G +L  VLA   G
Sbjct: 64  HGKKVLTSLGDAIKNLDDLKGTFAQLSEL---HCDKLHVDPENFRLLGNVLVTVLAIHFG 120

Query: 469 SGFTAEARQAWKNGLAALVAGIS 537
             FT E + +W+  +  + + +S
Sbjct: 121 KEFTPEVQASWQKMVTGVASALS 143



>pir:HBRB4 hemoglobin epsilon chain - rabbit>prf:0908261A    
           globin beta4 - Oryctolagus cuniculus (domestic
           rabbit)>gp:RABBGLOB_1 [M18818] gi:164791  Rabbit
           beta-like globin gene cluster encoding the epsilon,
           gamma, delta (pseudogene) and beta globin polypeptides,
           complete cds. [Oryctolagus cuniculus]
          Length = 147

 Score = 45.4 bits (106), Expect = 6e-04
 Identities = 36/140 (25%), Positives = 63/140 (44%), Gaps = 2/140 (1%)
 Frame = +1

Query: 124 ERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLAQAY 300
           E+ +I K W Q   D +   + L R +  +P  Q+ F  F N+  +  ++ N    A   
Sbjct: 8   EKCIISKQWGQVNID-ETGGEALGRLLVVYPWTQRFFDNFGNLSSSSAIMGNPKVKAHGK 66

Query: 301 TILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELGSGF 477
            +L      I+++ + +    +L+ L   H  +    P  F+  G +L  VLA   G  F
Sbjct: 67  KVLTSFGDAIKNMDNLKGAFAKLSEL---HCDKLHVDPENFKLLGNVLLIVLATHFGKEF 123

Query: 478 TAEARQAWKNGLAALVAGIS 537
           T E + AW+     LV+G++
Sbjct: 124 TPEVQAAWQK----LVSGVA 139



>sp:HBE_RABIT Hemoglobin epsilon chain (Beta-4).
          Length = 146

 Score = 45.4 bits (106), Expect = 6e-04
 Identities = 36/140 (25%), Positives = 63/140 (44%), Gaps = 2/140 (1%)
 Frame = +1

Query: 124 ERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLAQAY 300
           E+ +I K W Q   D +   + L R +  +P  Q+ F  F N+  +  ++ N    A   
Sbjct: 7   EKCIISKQWGQVNID-ETGGEALGRLLVVYPWTQRFFDNFGNLSSSSAIMGNPKVKAHGK 65

Query: 301 TILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELGSGF 477
            +L      I+++ + +    +L+ L   H  +    P  F+  G +L  VLA   G  F
Sbjct: 66  KVLTSFGDAIKNMDNLKGAFAKLSEL---HCDKLHVDPENFKLLGNVLLIVLATHFGKEF 122

Query: 478 TAEARQAWKNGLAALVAGIS 537
           T E + AW+     LV+G++
Sbjct: 123 TPEVQAAWQK----LVSGVA 138



>spu:MYG_CHIRA Myoglobin.>sp:MYG_CHIRA Myoglobin.
          Length = 146

 Score = 45.4 bits (106), Expect = 6e-04
 Identities = 33/142 (23%), Positives = 65/142 (45%), Gaps = 2/142 (1%)
 Frame = +1

Query: 133 LIRKTWDQAKKDGDV-APQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQAYTIL 309
           ++ K W   + D       VL R    HPE  K+F KFA +   +L  +    A   T+L
Sbjct: 5   MVLKCWGPMEADHATHGSLVLTRLFTEHPETLKLFPKFAGIAHGDLAGDAGVSAHGATVL 64

Query: 310 AGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVM-FEQFGGILEEVLAEELGSGFTAE 486
             L  ++++  +    A  L  L  +H  +   P++ F+    ++ +V+ E+  +G  A 
Sbjct: 65  NKLGDLLKARGAH---AALLKPLSSSHATKHKIPIINFKLIAEVIGKVMEEK--AGLDAA 119

Query: 487 ARQAWKNGLAALVAGISKNLKK 552
            + A +N +A ++  +  + K+
Sbjct: 120 GQTALRNVMAIIITDMEADYKE 141



>spu:HBB_TACAC Hemoglobin beta chain.>sp:HBB_TACAC Hemoglobin beta
           chain.>pir:HBTG hemoglobin beta chain - Australian
           echidna>prf:721937A      hemoglobin beta - Tachyglossus
           aculeatus aculeatus
          Length = 146

 Score = 45.4 bits (106), Expect = 6e-04
 Identities = 36/147 (24%), Positives = 66/147 (44%), Gaps = 2/147 (1%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFL 288
           LS  E++ +   W     + ++  + L R +  +P  Q+ F  F ++  A+ ++ N    
Sbjct: 3   LSGSEKTAVTNLWGHVNVN-ELGGEALGRLLVVYPWTQRFFESFGDLSSADAVMGNAKVK 61

Query: 289 AQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEEL 465
           A    +L      +++L + +    +L+ L   H  +    P  F + G +L  VLA   
Sbjct: 62  AHGAKVLTSFGDALKNLDNLKGTFAKLSEL---HCDKLHVDPENFNRLGNVLVVVLARHF 118

Query: 466 GSGFTAEARQAWKNGLAALVAGISKNL 546
              FT EA+ AW+     LV+G+S  L
Sbjct: 119 SKEFTPEAQAAWQK----LVSGVSHAL 141



>spu:HBG1_PONPY Hemoglobin gamma-1 chain.>sp:HBG1_PONPY Hemoglobin
           gamma-1 chain.
          Length = 146

 Score = 45.4 bits (106), Expect = 6e-04
 Identities = 34/143 (23%), Positives = 61/143 (41%), Gaps = 2/143 (1%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLA 291
           +  +++ I   W +   + D   + L R +  +P  Q+ F  F N+  A  ++ N    A
Sbjct: 4   TEEDKATITSLWGKVNVE-DAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKA 62

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
               +L  L   I++L   +    QL+ L   H  +    P  F   G +L  VLA   G
Sbjct: 63  HGKKVLTSLGDAIKNLDDLKGTFAQLSEL---HCDKLHVDPENFRLLGNVLVTVLAIHFG 119

Query: 469 SGFTAEARQAWKNGLAALVAGIS 537
             FT E + +W+  +  + + +S
Sbjct: 120 KEFTPEVQASWQKMVTGVASALS 142



>gp:CAU71056_1 [U71056] gi:10312069  myoglobin [Cryodraco
           antarcticus]
          Length = 147

 Score = 45.1 bits (105), Expect = 7e-04
 Identities = 33/142 (23%), Positives = 63/142 (44%), Gaps = 2/142 (1%)
 Frame = +1

Query: 133 LIRKTWDQAKKDGDV-APQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQAYTIL 309
           ++ K W   + D       VL R    HPE  K+F KFA +   +L  +    A   T+L
Sbjct: 6   MVLKCWGPVEADHATHGSLVLTRLFTEHPETLKLFPKFAGIAHGDLAGDAGVSAHGATVL 65

Query: 310 AGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVM-FEQFGGILEEVLAEELGSGFTAE 486
             L  ++++       A  L  L  +H  +   P++ F     ++ +V+ E+  +G  A 
Sbjct: 66  KKLGDLLKARGGH---AALLKPLSSSHATKHKIPIINFTLIAEVIGKVMEEK--AGLDAA 120

Query: 487 ARQAWKNGLAALVAGISKNLKK 552
            + A +N +A ++  +  + K+
Sbjct: 121 GQTALRNVMAIIITDMEADYKE 142



>gp:AF072681_1 [AF072681] gi:3283984  gamma globin [Tarsius
           bancanus]
          Length = 147

 Score = 45.1 bits (105), Expect = 7e-04
 Identities = 32/142 (22%), Positives = 63/142 (43%), Gaps = 2/142 (1%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLA 291
           ++ E+++I   W +   + +   + L R +  +P  Q+ F  F N+  A  ++ N    A
Sbjct: 5   TAEEKAIITSLWAKVNVE-ETGGEALGRLLVVYPWTQRFFDNFGNLSSASAIMGNPKVKA 63

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
               +L+ L    ++++  + + +    L   H  R    P  F   G +L  VLA   G
Sbjct: 64  HGKKVLSSLG---EAVTHMDDLKDAFAHLSELHCDRLHVDPENFRLLGNVLVIVLAHHFG 120

Query: 469 SGFTAEARQAWKNGLAALVAGI 534
             FT + + AWK  ++A+   +
Sbjct: 121 REFTPQVQAAWKKLMSAVAIAL 142



>pir:HBTR4 hemoglobin IV beta chain - rainbow trout (tentative
           sequence)
          Length = 147

 Score = 45.1 bits (105), Expect = 7e-04
 Identities = 37/142 (26%), Positives = 65/142 (45%), Gaps = 3/142 (2%)
 Frame = +1

Query: 124 ERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANV-PQAELLSNGNFLAQAY 300
           ERS I   W +   D ++ PQ L R +   P  Q+ FS F N+   A ++ N        
Sbjct: 7   ERSAIVGLWGKISVD-EIGPQALARLLIVSPWTQRHFSTFGNLSTPAAIMGNPAVAKHGK 65

Query: 301 TILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELGSG- 474
           T++ GL+  +Q+L     + N    L   H  +    P  F      +   +A +LG   
Sbjct: 66  TVMHGLDRAVQNLDD---IKNTYATLSVMHSEKLHVDPDNFRLLADCITVCVAAKLGPAV 122

Query: 475 FTAEARQAWKNGLAALVAGISK 540
           F+A+ ++A++  LA +V+ + +
Sbjct: 123 FSADTQEAFQKFLAVVVSALGR 144



>pir:HGHUG hemoglobin gamma-G chain [validated] - human>pir:HGCZG
           hemoglobin gamma-G chain - chimpanzee>pir:I37025
           hemoglobin gamma-G chain - gorilla>prf:1413312A    
           embryonic globin gamma - Galago crassicaudatus
           (thick-tailed bush baby)>gp:BC010914_1 [BC010914]
           gi:15012034  Similar to hemoglobin, gamma G [Homo
           sapiens]>gp:BC029387_1 [BC029387] gi:20809485
           hemoglobin, gamma G [Homo sapiens]>gp:CHPGM12GLB_1
           [M92294] gi:176780  gamma-1 globin [Pan
           troglodytes]>gp:GGGGGLOG_1 [X03111] gi:22888
           G-gamma-globin [Gorilla gorilla]>gp:GORGM12GLB_1
           [M92295] gi:177054  gamma-1 globin [Gorilla
           gorilla]>gp:HSGGL4_1 [V00515] gi:31733  G-gamma-globin
           [Homo sapiens]>gp:HUMGAMGLOA_1 [M91036] gi:182962
           G-gamma globin [Homo sapiens]>gp:HUMGAMGLOB_1 [M91037]
           gi:182965  G-gamma globin [Homo sapiens]>gp:HUMHBB_2
           [U01317] gi:455994  HBG2 gene product [Homo
           sapiens]>gp:PTGGGLOG_1 [X03109] gi:38220  G-gamma-globin
           [Pan troglodytes]>gpu:BC029387_1 [BC029387] gi:20809485 
           A-gamma globin [Homo sapiens]>gpu:BC010914_1 [BC010914]
           gi:15012034  A-gamma globin [Homo sapiens]
          Length = 147

 Score = 45.1 bits (105), Expect = 7e-04
 Identities = 34/143 (23%), Positives = 61/143 (41%), Gaps = 2/143 (1%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLA 291
           +  +++ I   W +   + D   + L R +  +P  Q+ F  F N+  A  ++ N    A
Sbjct: 5   TEEDKATITSLWGKVNVE-DAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKA 63

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
               +L  L   I+ L   +    QL+ L   H  +    P  F+  G +L  VLA   G
Sbjct: 64  HGKKVLTSLGDAIKHLDDLKGTFAQLSEL---HCDKLHVDPENFKLLGNVLVTVLAIHFG 120

Query: 469 SGFTAEARQAWKNGLAALVAGIS 537
             FT E + +W+  +  + + +S
Sbjct: 121 KEFTPEVQASWQKMVTGVASALS 143



>spu:HBB_ELEEL Hemoglobin beta chain.>sp:HBB_ELEEL Hemoglobin beta
           chain.>pir:S03400 hemoglobin beta chain - electric
           eel>prf:1509217B      hemoglobin beta - Electrophorus
           electricus (electric eel)
          Length = 147

 Score = 45.1 bits (105), Expect = 7e-04
 Identities = 37/146 (25%), Positives = 64/146 (43%), Gaps = 3/146 (2%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQ-AELLSNGNFL 288
           L+  +R  I   W     D ++ PQ L R +  +P  Q+ F+ F N+   A ++ N    
Sbjct: 3   LTEAQRGAIVNLWGHLSPD-EIGPQALARLLIVYPWTQRYFASFGNISSAAAIMGNPKVA 61

Query: 289 AQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEEL 465
           A    ++  L+  +++L++   +     AL   H  +    P  F          +A +L
Sbjct: 62  AHGKVVVGALDKAVKNLNN---IKGTYAALSTIHSEKLHVDPDNFRLLAESFTVSVAMKL 118

Query: 466 G-SGFTAEARQAWKNGLAALVAGISK 540
           G SGF AE + A    LA +V+ + K
Sbjct: 119 GPSGFNAETQHALAKFLAEVVSALGK 144



>spu:HBB4_ONCMY Hemoglobin beta-IV chain.>sp:HBB4_ONCMY Hemoglobin
           beta-IV chain.>prf:1009195A      hemoglobin IV beta -
           Salmo gairdneri
          Length = 147

 Score = 45.1 bits (105), Expect = 7e-04
 Identities = 37/142 (26%), Positives = 65/142 (45%), Gaps = 3/142 (2%)
 Frame = +1

Query: 124 ERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANV-PQAELLSNGNFLAQAY 300
           ERS I   W +   D ++ PQ L R +   P  Q+ FS F N+   A ++ N        
Sbjct: 7   ERSAIVGLWGKISVD-EIGPQALARLLIVSPWTQRHFSTFGNLSTPAAIMGNPAVAKHGK 65

Query: 301 TILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELGSG- 474
           T++ GL+  +Q+L     + N    L   H  +    P  F      +   +A +LG   
Sbjct: 66  TVMHGLDRAVQNLDD---IKNTYATLSVMHSEKLHVDPDNFRLLADCITVCVAAKLGPAV 122

Query: 475 FTAEARQAWKNGLAALVAGISK 540
           F+A+ ++A++  LA +V+ + +
Sbjct: 123 FSADTQEAFQKFLAVVVSALGR 144



>gp:XELBETAA_1 [M32456] gi:213975  X.borealis beta-I globin mRNA,
           complete cds. [Xenopus borealis]
          Length = 146

 Score = 45.1 bits (105), Expect = 7e-04
 Identities = 34/144 (23%), Positives = 63/144 (43%), Gaps = 1/144 (0%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFL 288
           L++H+R LI  TW +      +  + L R +  +P  Q+ FS F N+  A+ +  N    
Sbjct: 3   LTAHDRQLINSTWGKVCAK-TIGKEALGRLLWTYPWTQRYFSSFGNLNSADAVFHNEAVA 61

Query: 289 AQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELG 468
           A    ++  +   I+ +   +    QL+      +     P  F++FGG L   LA +  
Sbjct: 62  AHGEKVVTSIGEAIKHMDDIKGYYAQLSKYHS--ETLHVDPCNFKRFGGCLSISLARQFH 119

Query: 469 SGFTAEARQAWKNGLAALVAGISK 540
             +T E   A+++   A+   + K
Sbjct: 120 EEYTPELHAAYEHLFDAIADALGK 143



>sp:HBG_TARBA Hemoglobin gamma chain.
          Length = 146

 Score = 45.1 bits (105), Expect = 7e-04
 Identities = 32/142 (22%), Positives = 63/142 (43%), Gaps = 2/142 (1%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLA 291
           ++ E+++I   W +   + +   + L R +  +P  Q+ F  F N+  A  ++ N    A
Sbjct: 4   TAEEKAIITSLWAKVNVE-ETGGEALGRLLVVYPWTQRFFDNFGNLSSASAIMGNPKVKA 62

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
               +L+ L    ++++  + + +    L   H  R    P  F   G +L  VLA   G
Sbjct: 63  HGKKVLSSLG---EAVTHMDDLKDAFAHLSELHCDRLHVDPENFRLLGNVLVIVLAHHFG 119

Query: 469 SGFTAEARQAWKNGLAALVAGI 534
             FT + + AWK  ++A+   +
Sbjct: 120 REFTPQVQAAWKKLMSAVAIAL 141



>spu:HBG2_PANTR Hemoglobin gamma-G chain (Hemoglobin
           gamma-2).>prf:630483A      hemoglobin gamma - Homo
           sapiens (man)
          Length = 146

 Score = 45.1 bits (105), Expect = 7e-04
 Identities = 34/143 (23%), Positives = 61/143 (41%), Gaps = 2/143 (1%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLA 291
           +  +++ I   W +   + D   + L R +  +P  Q+ F  F N+  A  ++ N    A
Sbjct: 4   TEEDKATITSLWGKVNVE-DAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKA 62

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
               +L  L   I+ L   +    QL+ L   H  +    P  F+  G +L  VLA   G
Sbjct: 63  HGKKVLTSLGDAIKHLDDLKGTFAQLSEL---HCDKLHVDPENFKLLGNVLVTVLAIHFG 119

Query: 469 SGFTAEARQAWKNGLAALVAGIS 537
             FT E + +W+  +  + + +S
Sbjct: 120 KEFTPEVQASWQKMVTGVASALS 142



>spu:MYG_CRYAN Myoglobin.>sp:MYG_CRYAN Myoglobin.
          Length = 146

 Score = 45.1 bits (105), Expect = 7e-04
 Identities = 33/142 (23%), Positives = 63/142 (44%), Gaps = 2/142 (1%)
 Frame = +1

Query: 133 LIRKTWDQAKKDGDV-APQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQAYTIL 309
           ++ K W   + D       VL R    HPE  K+F KFA +   +L  +    A   T+L
Sbjct: 5   MVLKCWGPVEADHATHGSLVLTRLFTEHPETLKLFPKFAGIAHGDLAGDAGVSAHGATVL 64

Query: 310 AGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVM-FEQFGGILEEVLAEELGSGFTAE 486
             L  ++++       A  L  L  +H  +   P++ F     ++ +V+ E+  +G  A 
Sbjct: 65  KKLGDLLKARGGH---AALLKPLSSSHATKHKIPIINFTLIAEVIGKVMEEK--AGLDAA 119

Query: 487 ARQAWKNGLAALVAGISKNLKK 552
            + A +N +A ++  +  + K+
Sbjct: 120 GQTALRNVMAIIITDMEADYKE 141



>gp:HUMHBGG_1 [M15386] gi:183885  hemoglobin gamma-G [Homo sapiens]
          Length = 152

 Score = 45.1 bits (105), Expect = 7e-04
 Identities = 34/143 (23%), Positives = 61/143 (41%), Gaps = 2/143 (1%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLA 291
           +  +++ I   W +   + D   + L R +  +P  Q+ F  F N+  A  ++ N    A
Sbjct: 10  TEEDKATITSLWGKVNVE-DAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKA 68

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
               +L  L   I+ L   +    QL+ L   H  +    P  F+  G +L  VLA   G
Sbjct: 69  HGKKVLTSLGDAIKHLDDLKGTFAQLSEL---HCDKLHVDPENFKLLGNVLVTVLAIHFG 125

Query: 469 SGFTAEARQAWKNGLAALVAGIS 537
             FT E + +W+  +  + + +S
Sbjct: 126 KEFTPEVQASWQKMVTGVASALS 148



>prf:2415425J      globin:ISOTYPE=Cpa 4-1 - Chironomus
           pallidivittatus>prf:2415425K      globin:ISOTYPE=Cpa 4-2
           - Chironomus pallidivittatus>gp:CPGGCE_4 [Y10623]
           gi:1805726  globin Cpa 4-1 gene product [Chironomus
           pallidivittatus]>gp:CPGGCE_5 [Y10623] gi:1805727  globin
           Cpa 4-2 gene product [Chironomus pallidivittatus]
          Length = 151

 Score = 45.1 bits (105), Expect = 7e-04
 Identities = 29/109 (26%), Positives = 53/109 (48%)
 Frame = +1

Query: 103 ASILSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGN 282
           AS L++ + S ++ ++DQ K D   +  +L+   KA P  Q  FS+FA      +  +  
Sbjct: 13  ASALTADQISTVQASFDQVKGD---SVGILYAVFKADPSIQAKFSQFAGKDLDSIKGSAE 69

Query: 283 FLAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQF 429
           F + A  I+   + ++  L +   ++  ++    +HKPRGAT      F
Sbjct: 70  FASHAGKIVGFFSKIVGDLPN---ISGDVDTFVASHKPRGATHDQLNNF 115



>spu:GLB8_CHITH Globin CTT-VIII.>sp:GLB8_CHITH Globin
           CTT-VIII.>pir:GGICEH globin CTT-VIII - midge (Chironomus
           thummi thummi)>prf:0706241A      hemoglobin CTT VIII -
           Chironomus thummi thummi
          Length = 151

 Score = 45.1 bits (105), Expect = 7e-04
 Identities = 28/121 (23%), Positives = 56/121 (46%), Gaps = 3/121 (2%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLA 291
           +S+ + +L + +W+  K +      +L+   KA+P+ Q  F +FA      +  + +F  
Sbjct: 5   MSADQLALFKSSWNTVKHN---EVDILYAVFKANPDIQAKFPQFAGKDLDSIKDSADFAV 61

Query: 292 QAYTILAGLNVVIQSLSSQE---LMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEE 462
            +  I+   + VI  + + E    +   ++ L  +HK RG     FE+F   L + L+  
Sbjct: 62  HSGRIVGFFSEVIGLIGNPENRPALKTLIDGLASSHKARGIEKAQFEEFRASLVDYLSHH 121

Query: 463 L 465
           L
Sbjct: 122 L 122



>sp:HBB1_XENBO Hemoglobin beta-1 chain (Major).>pir:E25929
           hemoglobin beta-I chain - Kenyan clawed frog
          Length = 145

 Score = 45.1 bits (105), Expect = 7e-04
 Identities = 34/144 (23%), Positives = 63/144 (43%), Gaps = 1/144 (0%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFL 288
           L++H+R LI  TW +      +  + L R +  +P  Q+ FS F N+  A+ +  N    
Sbjct: 2   LTAHDRQLINSTWGKVCAK-TIGKEALGRLLWTYPWTQRYFSSFGNLNSADAVFHNEAVA 60

Query: 289 AQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELG 468
           A    ++  +   I+ +   +    QL+      +     P  F++FGG L   LA +  
Sbjct: 61  AHGEKVVTSIGEAIKHMDDIKGYYAQLSKYHS--ETLHVDPCNFKRFGGCLSISLARQFH 118

Query: 469 SGFTAEARQAWKNGLAALVAGISK 540
             +T E   A+++   A+   + K
Sbjct: 119 EEYTPELHAAYEHLFDAIADALGK 142



>spu:HBB2_TELPE Hemoglobin beta-2 chain.
          Length = 145

 Score = 44.7 bits (104), Expect = 0.001
 Identities = 35/145 (24%), Positives = 60/145 (41%), Gaps = 2/145 (1%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLS-NGNFL 288
           L+  E   I   W +      V  + L R +  +P  Q+ FS F N+  A+ +S N   +
Sbjct: 3   LTDQEIKYINAIWSKVDYK-QVGGEALARLLIVYPWTQRYFSTFGNLASADAISHNSKVI 61

Query: 289 AQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEEL 465
           A    +L  +   ++ L + +  A     L   H  +    P  F +FGG++  VLA   
Sbjct: 62  AHGEKVLRSIGEALKHLDNLKGYAK----LSQYHSEKLHVDPANFVRFGGVVVIVLAHHF 117

Query: 466 GSGFTAEARQAWKNGLAALVAGISK 540
              FT E + A++     +   + K
Sbjct: 118 HEEFTPEVQAAFEKAFGGVADAVGK 142



>spu:HBG2_PONPY Hemoglobin gamma-2 chain.>sp:HBG2_PONPY Hemoglobin
           gamma-2 chain.
          Length = 146

 Score = 44.7 bits (104), Expect = 0.001
 Identities = 33/143 (23%), Positives = 61/143 (42%), Gaps = 2/143 (1%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLA 291
           +  +++ I   W +   + D   + L R +  +P  Q+ F  F N+  A  ++ N    A
Sbjct: 4   TEEDKATITSLWGKLNVE-DAGGETLGRLLLVYPWTQRFFDSFGNLSSASAIMGNPKVKA 62

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
               +L  L   +++L   +    QL+ L   H  +    P  F   G +L  VLA   G
Sbjct: 63  HGKKVLTSLGDAVKNLDDLKGTFAQLSEL---HCDKLHVDPENFRLLGNVLVTVLAIHFG 119

Query: 469 SGFTAEARQAWKNGLAALVAGIS 537
             FT E + +W+  +  + + +S
Sbjct: 120 KEFTPEVQASWQKMVTGVASALS 142



>spu:HBB_DIDMA Hemoglobin beta-M chain.>sp:HBB_DIDMA Hemoglobin
           beta-M chain.
          Length = 146

 Score = 44.7 bits (104), Expect = 0.001
 Identities = 37/147 (25%), Positives = 64/147 (43%), Gaps = 2/147 (1%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQ-AELLSNGNFL 288
           L+S E++ I   W + + D     + L R +  +P   + F  F ++     ++SN    
Sbjct: 3   LTSEEKNCITTIWSKVQVD-QTGGEALGRMLVVYPWTTRFFGSFGDLSSPGAVMSNSKVQ 61

Query: 289 AQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEEL 465
           A    +L      ++ L + +    +L+ L   H  +    P  F+  G I+   LAE  
Sbjct: 62  AHGAKVLTSFGEAVKHLDNLKGTYAKLSEL---HCDKLHVDPENFKMLGNIIVICLAEHF 118

Query: 466 GSGFTAEARQAWKNGLAALVAGISKNL 546
           G  FT E + AW+     LVAG++  L
Sbjct: 119 GKDFTPECQVAWQK----LVAGVAHAL 141



>gpu:AY450928_1 [AY450928] gi:42415681  beta globin [Macropus
           eugenii]
          Length = 147

 Score = 44.7 bits (104), Expect = 0.001
 Identities = 38/147 (25%), Positives = 68/147 (45%), Gaps = 2/147 (1%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFL 288
           L++ E++ I   W +   +     + L R +  +P   + F  F ++  A+ ++SN   L
Sbjct: 4   LTAEEKNAITSLWGKVAIE-QTGGEALGRLLIVYPWTSRFFDHFGDLSNAKAVMSNPKVL 62

Query: 289 AQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEEL 465
           A    +L      I++L + +    +L+ L   H  +    P  F+  G I+   LAE  
Sbjct: 63  AHGAKVLVAFGDAIKNLDNLKGTFAKLSEL---HCDKLHVDPENFKLLGNIIVICLAEHF 119

Query: 466 GSGFTAEARQAWKNGLAALVAGISKNL 546
           G  FT +A+ AW+     LVAG++  L
Sbjct: 120 GKEFTIDAQVAWQK----LVAGVANAL 142



>gp:AB034757_1 [AB034757] gi:6329445  larval beta-globin [Hynobius
           retardatus]
          Length = 147

 Score = 44.7 bits (104), Expect = 0.001
 Identities = 36/144 (25%), Positives = 59/144 (40%), Gaps = 1/144 (0%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQ-AELLSNGNFLA 291
           ++ E++ I   W Q   + D   + L R +  +P  Q+ FS F ++   A + +N    A
Sbjct: 5   TAEEKAAISSVWKQVNVESD-GQEALARLLIVYPWTQRYFSSFGDLSSPAAICANAKVRA 63

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELGS 471
               +L+ L      L   +     L+ L          P  F      L  VLA +LG+
Sbjct: 64  HGKKVLSALGAGANHLDDIKGNFADLSKLHA--DTLHVDPNNFLLLANCLVIVLARKLGA 121

Query: 472 GFTAEARQAWKNGLAALVAGISKN 543
            F  +   AW+  LA   A +S+N
Sbjct: 122 AFNPQVHAAWEKFLAVSTAALSRN 145



>gp:ORAGM12GLB_2 [M92296] gi:342822  gamma-2 globin [Pongo
           pygmaeus]>gp:ORAHBG2F_1 [M16209] gi:342838  Orangutan
           gamma-2-fetal globin gene, complete cds. [Pongo
           pygmaeus]
          Length = 147

 Score = 44.7 bits (104), Expect = 0.001
 Identities = 33/143 (23%), Positives = 61/143 (42%), Gaps = 2/143 (1%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLA 291
           +  +++ I   W +   + D   + L R +  +P  Q+ F  F N+  A  ++ N    A
Sbjct: 5   TEEDKATITSLWGKLNVE-DAGGETLGRLLLVYPWTQRFFDSFGNLSSASAIMGNPKVKA 63

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
               +L  L   +++L   +    QL+ L   H  +    P  F   G +L  VLA   G
Sbjct: 64  HGKKVLTSLGDAVKNLDDLKGTFAQLSEL---HCDKLHVDPENFRLLGNVLVTVLAIHFG 120

Query: 469 SGFTAEARQAWKNGLAALVAGIS 537
             FT E + +W+  +  + + +S
Sbjct: 121 KEFTPEVQASWQKMVTGVASALS 143



>gp:BC010913_1 [BC010913] gi:15012032  Similar to hemoglobin, gamma
           A [Homo sapiens]>gpu:BC010913_1 [BC010913] gi:15012032
           A-gamma globin [Homo sapiens]
          Length = 147

 Score = 44.7 bits (104), Expect = 0.001
 Identities = 34/143 (23%), Positives = 61/143 (41%), Gaps = 2/143 (1%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLA 291
           +  +++ I   W +   + D   + L R +  +P  Q+ F  F N+  A  ++ N    A
Sbjct: 5   TEEDKATITSLWGKVNVE-DAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKA 63

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
               +L  L    + L   +    QL+ L   H  +    P  F+  G +L  VLA   G
Sbjct: 64  HGKKVLTSLGDATKHLDDLKGTFAQLSEL---HCDKLHVDPENFKLLGNVLVTVLAIHFG 120

Query: 469 SGFTAEARQAWKNGLAALVAGIS 537
             FT E + +W+  + A+ + +S
Sbjct: 121 KEFTPEVQASWQKMVTAVASALS 143



>pir:HBOP hemoglobin beta chain - North American
           opossum>prf:1408288B      hemoglobin epsilonM -
           Didelphis sp.>gp:OPOHBBB_1 [J03643] gi:164285  Opossum
           beta-hemoglobin beta-M gene, complete cds. [Didelphis
           virginiana]
          Length = 147

 Score = 44.7 bits (104), Expect = 0.001
 Identities = 37/147 (25%), Positives = 64/147 (43%), Gaps = 2/147 (1%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQ-AELLSNGNFL 288
           L+S E++ I   W + + D     + L R +  +P   + F  F ++     ++SN    
Sbjct: 4   LTSEEKNCITTIWSKVQVD-QTGGEALGRMLVVYPWTTRFFGSFGDLSSPGAVMSNSKVQ 62

Query: 289 AQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEEL 465
           A    +L      ++ L + +    +L+ L   H  +    P  F+  G I+   LAE  
Sbjct: 63  AHGAKVLTSFGEAVKHLDNLKGTYAKLSEL---HCDKLHVDPENFKMLGNIIVICLAEHF 119

Query: 466 GSGFTAEARQAWKNGLAALVAGISKNL 546
           G  FT E + AW+     LVAG++  L
Sbjct: 120 GKDFTPECQVAWQK----LVAGVAHAL 142



>prf:0812199A      globin beta-like y - Mus musculus (house mouse)
          Length = 126

 Score = 44.3 bits (103), Expect = 0.001
 Identities = 32/125 (25%), Positives = 54/125 (42%), Gaps = 2/125 (1%)
 Frame = +1

Query: 169 GDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLAQAYTILAGLNVVIQSLSS 345
           G V  + L R +  +P   + F  F N+  A  ++ N    A    +L      I++L +
Sbjct: 1   GKVGGEALGRLLVVYPWTHRFFDSFGNLSSASAIMGNPRVKAHGKKVLTAFGESIKNLDN 60

Query: 346 QELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELGSGFTAEARQAWKNGLAAL 522
              + + L  L   H  +    P  F+  G +L  VLA   G+ F AE + AW+  +A +
Sbjct: 61  ---LKSALAKLSELHXDKLHVDPENFKLLGNVLVIVLASHFGNEFXAEMQAAWQKLVAGV 117

Query: 523 VAGIS 537
              +S
Sbjct: 118 ATALS 122



>pir:JC7791 myoglobin - thick-billed murre
          Length = 153

 Score = 44.3 bits (103), Expect = 0.001
 Identities = 35/137 (25%), Positives = 60/137 (43%), Gaps = 3/137 (2%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQAKKD-GDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFL 288
           LS  E   +   W + + D      QVL R  + HPE    F KF  +   + +     L
Sbjct: 2   LSDQEWQHVLTIWGKVESDLAGHGHQVLMRLFQDHPETLDRFEKFKGLKTPDQMKGSEDL 61

Query: 289 AQ-AYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQF-GGILEEVLAEE 462
            +   T+L  L  +++   + E   ++L  L   H  +   PV + +F    + +V+AE+
Sbjct: 62  KKHGVTVLTQLGKILKQKGNHE---SELKPLAQTHATKHKIPVKYLEFISEAIIKVIAEK 118

Query: 463 LGSGFTAEARQAWKNGL 513
             S F A+++ A K  L
Sbjct: 119 HASSFGADSQAAMKKAL 135



>gp:D88119_1 [D88119] gi:1644259  beta-globin [Cyprinus carpio]
          Length = 148

 Score = 44.3 bits (103), Expect = 0.001
 Identities = 33/141 (23%), Positives = 63/141 (44%), Gaps = 2/141 (1%)
 Frame = +1

Query: 124 ERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQ-AELLSNGNFLAQAY 300
           ERS I   W +   D ++ PQ L R +  +P  Q+ F+ F N+   A ++ N    A   
Sbjct: 8   ERSAIIGLWGKLNPD-EIRPQALARCLIVYPWTQRYFASFGNLSSPAAIMGNPKVAAHGR 66

Query: 301 TILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELG-SGF 477
           T++ GL   I+++ + +     L+ +    +     P  F      +    A + G S F
Sbjct: 67  TVMGGLERAIKNMDNIKATYAPLSVMHS--EKLHVDPDNFRLLADCITVCAAMKFGPSAF 124

Query: 478 TAEARQAWKNGLAALVAGISK 540
             + ++AW+  L  +V+ + +
Sbjct: 125 NPDVQEAWQKFLCVVVSALCR 145



>gp:UCU30878_1 [U30878] gi:945056  F-I hemoglobin [Urechis caupo]
          Length = 162

 Score = 44.3 bits (103), Expect = 0.001
 Identities = 37/137 (27%), Positives = 60/137 (43%), Gaps = 18/137 (13%)
 Frame = +1

Query: 178 APQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQAYTILAGLNVVIQSLSSQ--- 348
           A  + F+++ A+P     F KF++VP   L  N  + AQ  T++  L+ V+ +L      
Sbjct: 27  ADSIFFKYLTAYPGDLAFFHKFSSVPLYGLRWNPAYKAQTLTVINYLDKVVDALGGNAGA 86

Query: 349 ----ELMANQLNALGG-----------AHKPRGATPVMFEQFGGILEEVLAEELGSGFTA 483
               ++ ++   ALGG           +H   G TP  F Q   ++  V  EE  +  T 
Sbjct: 87  LMKAKVPSHDAIALGGNAGALMKAKVPSHDAMGITPKHFGQLLKLVGGVFQEEFSADPTT 146

Query: 484 EARQAWKNGLAALVAGI 534
            A  AW +    LVA +
Sbjct: 147 VA--AWGDAAGVLVAAM 161



>spu:GLB1_ARTSX Globin E1, extracellular.>sp:GLB1_ARTSX Globin E1,
           extracellular.>prf:1405276A      globin E1 - Artemia sp.
           (brine shrimp)
          Length = 147

 Score = 43.5 bits (101), Expect = 0.002
 Identities = 32/125 (25%), Positives = 55/125 (43%), Gaps = 6/125 (4%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQAKKD-GDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFL 288
           LS  E++ I  TW + + +  +V      +   AHPEYQ+MF  F  V  A L+ +  F 
Sbjct: 9   LSGLEKNAILDTWGKVRGNLQEVGKATFGKLFAAHPEYQQMFRFFQGVQLAFLVQSPKFA 68

Query: 289 AQAYTILAGLNVVIQSLS-SQELMANQLNALGGAHKPRGA----TPVMFEQFGGILEEVL 453
           A    +++ L+  + +L+   +     +  LG  H  RG        + E  G  ++E  
Sbjct: 69  AHTQRVVSALDQTLLALNRPSDQFVYMIKELGLDHINRGTDRSFVEYLKESLGDSVDEFT 128

Query: 454 AEELG 468
            +  G
Sbjct: 129 VQSFG 133



>sp:HBP2_CASGL Hemoglobin II.>pir:S13378 hemoglobin II - swamp
           oak>prf:1807352A      leghemoglobin II - Casuarina
           glauca (swamp oak)>gp:CGHBIIG_1 [X53950] gi:18015
           hemoglobin [Casuarina glauca]
          Length = 160

 Score = 43.5 bits (101), Expect = 0.002
 Identities = 33/148 (22%), Positives = 60/148 (40%), Gaps = 3/148 (2%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKD-GDVAPQVLFRFVKAHPEYQKMFS--KFANVPQAELLSNGNF 285
           +  + +L+ K+W   K + G++  +   +  +  P  QK+FS  K +NVP        + 
Sbjct: 10  TEEQEALVVKSWSAMKPNAGELGLKFFLKIFEIAPSAQKLFSFLKDSNVPLERNPKLKSH 69

Query: 286 LAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEEL 465
               + +     V ++      +  + L  LG +H   G     FE     L E + E +
Sbjct: 70  AMSVFLMTCESAVQLRKAGKVTVRESSLKKLGASHFKHGVADEHFEVTKFALLETIKEAV 129

Query: 466 GSGFTAEARQAWKNGLAALVAGISKNLK 549
              ++ E + AW      LVA I   +K
Sbjct: 130 PETWSPEMKNAWGEAYDKLVAAIKLEMK 157



>pir:A28141 globin, extracellular - brine shrimp (fragment)
          Length = 194

 Score = 43.5 bits (101), Expect = 0.002
 Identities = 32/125 (25%), Positives = 55/125 (43%), Gaps = 6/125 (4%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQAKKD-GDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFL 288
           LS  E++ I  TW + + +  +V      +   AHPEYQ+MF  F  V  A L+ +  F 
Sbjct: 56  LSGLEKNAILDTWGKVRGNLQEVGKATFGKLFAAHPEYQQMFRFFQGVQLAFLVQSPKFA 115

Query: 289 AQAYTILAGLNVVIQSLS-SQELMANQLNALGGAHKPRGA----TPVMFEQFGGILEEVL 453
           A    +++ L+  + +L+   +     +  LG  H  RG        + E  G  ++E  
Sbjct: 116 AHTQRVVSALDQTLLALNRPSDQFVYMIKELGLDHINRGTDRSFVEYLKESLGDSVDEFT 175

Query: 454 AEELG 468
            +  G
Sbjct: 176 VQSFG 180



>prf:0505220B      hemoglobin beta - Didelphis virginiana (North
           American opossum)
          Length = 146

 Score = 43.5 bits (101), Expect = 0.002
 Identities = 37/147 (25%), Positives = 62/147 (42%), Gaps = 2/147 (1%)
 Frame = +1

Query: 112 LSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQ-AELLSNGNFL 288
           L+S E++ I   W + + D     + L R +  +P   + F  F ++     ++SN    
Sbjct: 3   LTSEEKNCITTIWSKVQVD-QTGGEALGRMLVVYPWTTRFFGSFGDLSSPGAVMSNSKVQ 61

Query: 289 AQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEEL 465
           A    +L      ++ L   +    +L+ L   H  +    P  F+  G I+   LAE  
Sbjct: 62  AHGAKVLTSFGEAVKHLDDLKGTYAKLSEL---HCDKLHVDPENFKMLGBIIVICLAEHF 118

Query: 466 GSGFTAEARQAWKNGLAALVAGISKNL 546
           G  FT E   AW+     LVAG++  L
Sbjct: 119 GKDFTPECZVAWZK----LVAGVAHAL 141



>spu:HBB_PASMO Hemoglobin beta chain.>sp:HBB_PASMO Hemoglobin beta
           chain.>pir:B24625 hemoglobin beta chain - Eurasian tree
           sparrow>prf:1111200C      hemoglobin beta - Passer
           montanus (Eurasian tree sparrow)
          Length = 146

 Score = 43.5 bits (101), Expect = 0.002
 Identities = 34/132 (25%), Positives = 57/132 (42%), Gaps = 2/132 (1%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQ-AELLSNGNFLA 291
           ++ E+ LI   W +     +   + L R +  +P  Q+ F+ F N+     +L N    A
Sbjct: 4   TAEEKQLITGLWGKVNV-AECGGEALARLLIVYPWTQRFFASFGNLSSPTAVLGNPKVQA 62

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
               +L      +++L S +   +QL+ L   H  +    P  F   G IL  VLA   G
Sbjct: 63  HGKKVLTSFGEAVKNLDSIKNTFSQLSEL---HCDKLHVDPENFRLLGDILVVVLAAHFG 119

Query: 469 SGFTAEARQAWK 504
             FT + + AW+
Sbjct: 120 KDFTPDCQAAWQ 131



>spu:HBB_STUVU Hemoglobin beta chain.>sp:HBB_STUVU Hemoglobin beta
           chain.>pir:HBJS hemoglobin beta chain - common
           starling>prf:1004263C      hemoglobin beta - Sturnus
           vulgaris (common starling)
          Length = 146

 Score = 43.5 bits (101), Expect = 0.002
 Identities = 34/132 (25%), Positives = 57/132 (42%), Gaps = 2/132 (1%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQ-AELLSNGNFLA 291
           ++ E+ LI   W +     +   + L R +  +P  Q+ F+ F N+     +L N    A
Sbjct: 4   TAEEKQLITGLWGKVNV-AECGAEALARLLIVYPWTQRFFASFGNLSSPTAVLGNPKVQA 62

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
               +L      +++L S +   +QL+ L   H  +    P  F   G IL  VLA   G
Sbjct: 63  HGKKVLTSFGDAVKNLDSIKNTFSQLSEL---HCDKLHVDPENFRLLGDILVVVLAAHFG 119

Query: 469 SGFTAEARQAWK 504
             FT + + AW+
Sbjct: 120 KDFTPDCQAAWQ 131



>spu:HBB_ACCGE Hemoglobin beta chain.>sp:HBB_ACCGE Hemoglobin beta
           chain.>pir:C26544 hemoglobin beta chain -
           goshawk>prf:1306241C      hemoglobin beta - Accipiter
           gentilis (goshawk)
          Length = 146

 Score = 43.5 bits (101), Expect = 0.002
 Identities = 35/144 (24%), Positives = 63/144 (43%), Gaps = 2/144 (1%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLA 291
           ++ E+ LI   W +     D   + L R +  +P  Q+ F+ F N+  A  +L N    A
Sbjct: 4   AAEEKQLITGLWGKVNV-ADCGAEALARLLIVYPWTQRFFASFGNLSSATAVLGNPMVRA 62

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
               +L      +++L + +    QL+ L   H  +    P  F   G IL  VLA   G
Sbjct: 63  HGKKVLTSFGEAVKNLDNIKNTFAQLSEL---HCDKLHVDPENFRLLGDILIVVLAAHFG 119

Query: 469 SGFTAEARQAWKNGLAALVAGISK 540
             F+ + + AW+  + A+   +++
Sbjct: 120 KDFSPDCQAAWQKLVRAVAHALAR 143



>pir:S61518 two-domain hemoglobin - blood clam (Barbatia
           lima)>gp:BARHB2DCA_1 [D63931] gi:974720  two-domain
           chain of the polymeric hemoglobin (intracellular)
           [Barbatia lima]
          Length = 308

 Score = 43.5 bits (101), Expect = 0.002
 Identities = 35/141 (24%), Positives = 58/141 (40%), Gaps = 2/141 (1%)
 Frame = +1

Query: 127 RSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQAYTI 306
           +SLIR+TW+    D      ++    +  PE +K F++  +V    + +N        T+
Sbjct: 16  KSLIRQTWNMMAGDSKNGVDLMALLFQIAPESKKEFTRLGDVSPENIPNNRKLNGHGITL 75

Query: 307 LAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEEL--GSGFT 480
              L   +  L S   + +        H  RG   V F    G ++E LA+ L    G  
Sbjct: 76  WYALTSFVDQLDSPNDLEDLCRKFAVNHVARGVLDVRF----GWIKEPLAKLLRRNCGNC 131

Query: 481 AEARQAWKNGLAALVAGISKN 543
            EA QAW   +  + A + +N
Sbjct: 132 DEAIQAWWELIDVICAVVKEN 152



 Score = 40.8 bits (94), Expect = 0.014
 Identities = 31/139 (22%), Positives = 54/139 (38%)
 Frame = +1

Query: 85  ADDASEASILSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE 264
           A+   EA+   S  +SLIR+TW+    D     +++    +  PE +K F +  ++    
Sbjct: 157 AEKIEEAT--QSDNKSLIRETWEMIAGDRKNGVELMALLFEMAPESKKEFRRLGDISPEN 214

Query: 265 LLSNGNFLAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILE 444
           + +N        T+   L   +  L ++  + +        H  RG   V F      L 
Sbjct: 215 IPNNRKLNGHGITLWYALTSFVDQLDNKNDLEDLCRKFAVNHVSRGVLNVKFGWIKEPLA 274

Query: 445 EVLAEELGSGFTAEARQAW 501
           E+L  + GS        AW
Sbjct: 275 ELLRRKCGSRCEDRHINAW 293



>gp:PMU71152_1 [U71152] gi:1809302  myoglobin [Pagetopsis
           macropterus]
          Length = 141

 Score = 43.1 bits (100), Expect = 0.003
 Identities = 30/123 (24%), Positives = 58/123 (46%), Gaps = 1/123 (0%)
 Frame = +1

Query: 187 VLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQAYTILAGLNVVIQSLSSQELMANQ 366
           VL R    HPE  K+F KFA +   +L  +    A   T+L  L  ++++  +    A  
Sbjct: 19  VLTRLFTEHPETLKLFPKFAGIAHGDLAGDAGVSAHGATVLNKLGDLLKARGAH---AAL 75

Query: 367 LNALGGAHKPRGATPVM-FEQFGGILEEVLAEELGSGFTAEARQAWKNGLAALVAGISKN 543
           L  L  +H  +   P++ F+    ++ +V+ E+  +G  A  +   +N +A ++A +   
Sbjct: 76  LKPLSSSHATKHKIPIINFKLIAEVIGKVMEEK--AGVDAGGQTGLRNVMAVIIADMEAA 133

Query: 544 LKK 552
            K+
Sbjct: 134 YKE 136



>prf:1922276B      gamma globin - Tarsius sp. (tarsier)
          Length = 146

 Score = 43.1 bits (100), Expect = 0.003
 Identities = 31/142 (21%), Positives = 62/142 (42%), Gaps = 2/142 (1%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLA 291
           ++ E+++I   W +   + +   + L R +  +P  Q+ F  F N+  A  ++ N    A
Sbjct: 4   TAEEKAIITSLWAKVNVE-ETGGEALGRLLVVYPWTQRFFDNFGNLSSASAIMGNPKVKA 62

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
               +L+ L    ++++  + + +    L   H       P  F   G +L  VLA   G
Sbjct: 63  HGKKVLSSLG---EAVTHMDDLKDAFAHLSRLHCDELHVDPENFRLLGNVLVIVLAHHFG 119

Query: 469 SGFTAEARQAWKNGLAALVAGI 534
             FT + + AWK  ++A+   +
Sbjct: 120 REFTPQVQAAWKKLMSAVAIAL 141



>prf:0707234A      globin beta-like rho - Gallus gallus (chicken)
          Length = 146

 Score = 43.1 bits (100), Expect = 0.003
 Identities = 32/144 (22%), Positives = 60/144 (41%), Gaps = 2/144 (1%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQ-AELLSNGNFLA 291
           S+ E+ LI   W +   + +   + L R +  +P  Q+ F  F N+     ++ N    A
Sbjct: 4   SAEEKQLITSVWSKVNVE-ECGAEALARLLIVYPWTQRFFDNFGNLSSPTAIIGNPKVRA 62

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
               +L+     +++L +   + N    L   H  +    P  F   G IL  VLA    
Sbjct: 63  HGKKVLSSFGEAVKNLDN---IKNTYAKLSELHCEKLHVDPENFRLLGNILIIVLAAHFT 119

Query: 469 SGFTAEARQAWKNGLAALVAGISK 540
             FT E + AW+  ++ +   +++
Sbjct: 120 KDFTPECQAAWQKLVSVVAKALAR 143



>sp:HBG_CEBAP Hemoglobin gamma-1 and gamma-2 chains.>prf:1922276A   
             gamma globin - Cebus sp. (capuchin monkey)
          Length = 146

 Score = 43.1 bits (100), Expect = 0.003
 Identities = 36/149 (24%), Positives = 65/149 (43%), Gaps = 2/149 (1%)
 Frame = +1

Query: 106 SILSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQ-AELLSNGN 282
           S  ++ +++ I   W +   + D   + L R +  +P  Q+ F  F ++   + ++ N  
Sbjct: 1   SNFTAEDKAAITSLWAKVNVE-DAGGETLGRLLVVYPWTQRFFDSFGSLSSPSAIMGNPK 59

Query: 283 FLAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAE 459
             A    +L  L   I++L   +    QL+ L   H  +    P  F   G +L  VLA 
Sbjct: 60  VKAHGAKVLTSLGEAIKNLDDLKGTFGQLSEL---HCDKLHVDPENFRLLGNVLVTVLAV 116

Query: 460 ELGSGFTAEARQAWKNGLAALVAGISKNL 546
             G  FT E + +W+     +VAG++  L
Sbjct: 117 HHGKEFTPEVQASWQK----MVAGVASAL 141



>sp:HBB_GEOCR Hemoglobin beta chain.
          Length = 146

 Score = 43.1 bits (100), Expect = 0.003
 Identities = 34/130 (26%), Positives = 55/130 (42%), Gaps = 1/130 (0%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLA 291
           S  E+  I   W +   + +V  + L R +  +P  Q+ FS F N+     +L N   LA
Sbjct: 4   SCEEKQFITSLWAKVNVE-EVGGEALARLLIVYPWTQRFFSSFGNLSSPNAILHNAKVLA 62

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELGS 471
               +L      +++L + +    QL+ L    +     P  F+  G IL  VLA     
Sbjct: 63  HGKKVLTSFGEAVKNLDNIKKTFAQLSELHC--EKLHVDPENFKLLGNILIIVLATHFPK 120

Query: 472 GFTAEARQAW 501
            FT  ++ AW
Sbjct: 121 EFTPASQAAW 130



>spu:HBB_GEONI Hemoglobin beta chain.>sp:HBB_GEONI Hemoglobin beta
           chain.
          Length = 146

 Score = 43.1 bits (100), Expect = 0.003
 Identities = 34/127 (26%), Positives = 55/127 (42%), Gaps = 1/127 (0%)
 Frame = +1

Query: 124 ERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLAQAY 300
           E+  I   W +   + +V  + L R +  +P  Q+ FS F N+  A  +L N   LA   
Sbjct: 7   EKQYITSLWAKVNVE-EVGGEALARLLIVYPWTQRFFSSFGNLSSASAILHNAKVLAHGK 65

Query: 301 TILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELGSGFT 480
            +L      +++L + +    QL+ L    +     P  F+  G IL  VLA      FT
Sbjct: 66  KVLTSFGDAVKNLDNIKKTFAQLSELHC--EKLHVDPENFKLLGNILIIVLATRFPKEFT 123

Query: 481 AEARQAW 501
             ++ AW
Sbjct: 124 PASQAAW 130



>spu:HBB_PHACA Hemoglobin beta chain.>sp:HBB_PHACA Hemoglobin beta
           chain.>pir:HBCOG hemoglobin beta chain - great
           cormorant>prf:1501221B      hemoglobin beta -
           Phalacrocorax carbo (great cormorant)
          Length = 146

 Score = 43.1 bits (100), Expect = 0.003
 Identities = 35/145 (24%), Positives = 66/145 (45%), Gaps = 3/145 (2%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGNFLAQ 294
           ++ E+ LI   W +     +   + L R +  +P  Q+ F+ F N+  A  ++ GN + +
Sbjct: 4   TAEEKQLITGLWGKVNV-AECGAEALARLLIVYPWTQRFFASFGNLSSATAIT-GNPMVR 61

Query: 295 AY--TILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEEL 465
           A+   +L      +++L + +    QL+ L   H  +    P  F   G IL  VLA   
Sbjct: 62  AHGKKVLTSFGEAVKNLDNIKATFAQLSEL---HCDKLHVDPENFRLLGDILIIVLAAHF 118

Query: 466 GSGFTAEARQAWKNGLAALVAGISK 540
              FT E + AW+  + A+   +++
Sbjct: 119 AKDFTPECQAAWQKLVGAVAHALAR 143



>prf:2319207A      hemoglobin:SUBUNIT=beta - Geochelone
           carbonaria>gp:GCU63145_1 [U63145] gi:1518804  b-chain
           hemoglobin [Geochelone carbonaria]
          Length = 147

 Score = 43.1 bits (100), Expect = 0.003
 Identities = 34/130 (26%), Positives = 55/130 (42%), Gaps = 1/130 (0%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLA 291
           S  E+  I   W +   + +V  + L R +  +P  Q+ FS F N+     +L N   LA
Sbjct: 5   SCEEKQFITSLWAKVNVE-EVGGEALARLLIVYPWTQRFFSSFGNLSSPNAILHNAKVLA 63

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVLAEELGS 471
               +L      +++L + +    QL+ L    +     P  F+  G IL  VLA     
Sbjct: 64  HGKKVLTSFGEAVKNLDNIKKTFAQLSELHC--EKLHVDPENFKLLGNILIIVLATHFPK 121

Query: 472 GFTAEARQAW 501
            FT  ++ AW
Sbjct: 122 EFTPASQAAW 131



>pir:G00014 hemoglobin gamma-1 chain - brown capuchin>gp:CAU57043_1
           [U57043] gi:1401189  gamma globin [Cebus apella]
          Length = 147

 Score = 43.1 bits (100), Expect = 0.003
 Identities = 36/149 (24%), Positives = 65/149 (43%), Gaps = 2/149 (1%)
 Frame = +1

Query: 106 SILSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQ-AELLSNGN 282
           S  ++ +++ I   W +   + D   + L R +  +P  Q+ F  F ++   + ++ N  
Sbjct: 2   SNFTAEDKAAITSLWAKVNVE-DAGGETLGRLLVVYPWTQRFFDSFGSLSSPSAIMGNPK 60

Query: 283 FLAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAE 459
             A    +L  L   I++L   +    QL+ L   H  +    P  F   G +L  VLA 
Sbjct: 61  VKAHGAKVLTSLGEAIKNLDDLKGTFGQLSEL---HCDKLHVDPENFRLLGNVLVTVLAV 117

Query: 460 ELGSGFTAEARQAWKNGLAALVAGISKNL 546
             G  FT E + +W+     +VAG++  L
Sbjct: 118 HHGKEFTPEVQASWQK----MVAGVASAL 142



>sp:HBL_MAIZE Non-symbiotic hemoglobin (Hbm) (ZEAma
           GLB1).>gp:AY005818_1 [AY005818] gi:9931924  hemoglobin
           [Zea mays subsp. mays]>gpu:AY005818_1 [AY005818]
           gi:9931924  hemoglobin [Zea mays]
          Length = 165

 Score = 42.7 bits (99), Expect = 0.004
 Identities = 36/159 (22%), Positives = 66/159 (40%), Gaps = 4/159 (2%)
 Frame = +1

Query: 85  ADDASEASILSSHERSLIRKTWDQAKKDG-DVAPQVLFRFVKAHPEYQKMFS--KFANVP 255
           ADD   A +    + +L+ K+W   KKD  ++  +   +  +  P  ++MFS  + ++VP
Sbjct: 6   ADDG--AVVFGEEQEALVLKSWAVMKKDAANLGLRFFLKVFEIAPSAEQMFSFLRDSDVP 63

Query: 256 QAELLSNGNFLAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGG 435
             +           + +       ++      +    L  LG  H   G     FE  G 
Sbjct: 64  LEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRETTLKRLGATHLRYGVADGHFEVTGF 123

Query: 436 ILEEVLAEELGSG-FTAEARQAWKNGLAALVAGISKNLK 549
            L E + E L +  ++ E ++AW    + LVA I + +K
Sbjct: 124 ALLETIKEALPADMWSLEMKKAWAEAYSQLVAAIKREMK 162



>pir:S14575 globin D precursor - midge (Chironomus
           tentans)>gp:CTORFHB_3 [X56272] gi:7093  ORF D gene
           product [Chironomus tentans]
          Length = 161

 Score = 42.7 bits (99), Expect = 0.004
 Identities = 35/151 (23%), Positives = 61/151 (40%), Gaps = 3/151 (1%)
 Frame = +1

Query: 103 ASILSSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAELLSNGN 282
           A  +S+ +  LIR +W Q K +      +L    K HP+ Q  F +FA      L     
Sbjct: 16  ADPISADQADLIRSSWAQVKHN---EVDILAAVFKDHPDIQARFPQFAGKDVDSLKDTAA 72

Query: 283 FLAQAYTILAGLNVVIQSL---SSQELMANQLNALGGAHKPRGATPVMFEQFGGILEEVL 453
           F   A  I+  ++ ++  +   +++  M    N L   H  RG +   F +F   +   L
Sbjct: 73  FATHAGRIVGFISEIVALVGNEANRPAMNTLTNELATNHHNRGISKAQFNEFRASMTSYL 132

Query: 454 AEELGSGFTAEARQAWKNGLAALVAGISKNL 546
           +    + +      AW +GL  +   I  +L
Sbjct: 133 SHH--TTWNDATAAAWTHGLDNIFDAIFAHL 161



>spu:HBL1_ORYSA Non-symbiotic hemoglobin 1 (rHb1) (ORYsa
           GLB1a).>sp:HBL1_ORYSA Non-symbiotic hemoglobin 1 (rHb1)
           (ORYsa GLB1a).>pir:T04163 hemoglobin 1 -
           rice>prf:2404474B      hemoglobin - Oryza sativa
           (rice)>gp:AC103891_5 [AC103891] gi:20330762  Putative
           Non-symbiotic hemoglobin 1 [Oryza sativa (japonica
           cultivar-group)]>gp:AF335504_1 [AF335504] gi:14701802
           hemoglobin 1 [Oryza sativa (japonica
           cultivar-group)]>gp:OSU76029_1 [U76029] gi:2058498
           hemoglobin 1 [Oryza sativa (indica
           cultivar-group)]>gp:OSU76030_1 [U76030] gi:2058500
           hemoglobin 1 [Oryza sativa (indica
           cultivar-group)]>gpu:AF335504_1 [AF335504] gi:14701802
           hemoglobin 1 [Oryza sativa (japonica cultivar-group)]
          Length = 166

 Score = 42.7 bits (99), Expect = 0.004
 Identities = 37/161 (22%), Positives = 63/161 (38%), Gaps = 4/161 (2%)
 Frame = +1

Query: 88  DDASEASILSSHERSLIRKTWDQAKKDG-DVAPQVLFRFVKAHPEYQKMFSKFAN--VPQ 258
           D+ + A   S  + +L+ K+W   KKD  ++A +   +  +  P   +MFS   N  VP 
Sbjct: 6   DNNAVAVSFSEEQEALVLKSWAILKKDSANIALRFFLKIFEVAPSASQMFSFLRNSDVPL 65

Query: 259 AELLSNGNFLAQAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPRGATPVMFEQFGGI 438
            +           + +       ++      +    L  LG  H   G     FE     
Sbjct: 66  EKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRDTTLKRLGATHLKYGVGDAHFEVVKFA 125

Query: 439 LEEVLAEELGSGFTAEA-RQAWKNGLAALVAGISKNLKKAE 558
           L + + EE+ +   + A + AW      LVA I + +K AE
Sbjct: 126 LLDTIKEEVPADMWSPAMKSAWSEAYDHLVAAIKQEMKPAE 166



>sp:HBG_CHEME Hemoglobin gamma chain.
          Length = 146

 Score = 42.7 bits (99), Expect = 0.004
 Identities = 35/140 (25%), Positives = 62/140 (44%), Gaps = 2/140 (1%)
 Frame = +1

Query: 124 ERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQAE-LLSNGNFLAQAY 300
           E+++I   W +   + +   + L R +  +P  Q+ F  F N+  A  ++ N    A   
Sbjct: 7   EKAVITSLWGKVNVE-EAGGEALGRLLVVYPWTQRFFDNFGNLSSASAIMGNPKVKAHGK 65

Query: 301 TILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELGSGF 477
            +L  L   I+++   +     L+ L   H  R    P  F+  G  L  VLA+  G  F
Sbjct: 66  KVLTSLGEAIKNMDDLKGTFAHLSEL---HCDRLHVDPENFKLLGNELVIVLAKHFGKEF 122

Query: 478 TAEARQAWKNGLAALVAGIS 537
           T + + AW+     +VAG++
Sbjct: 123 TPQVQAAWQK----MVAGVA 138



>spu:HBB_PHACO Hemoglobin beta chain.>sp:HBB_PHACO Hemoglobin beta
           chain.>pir:HBFER hemoglobin beta chain - ring-necked
           pheasant>pir:S56104 hemoglobin beta chain -
           turkey>prf:0804242B      hemoglobin Abeta - Phasianus
           colchicus (ring-necked pheasant)>prf:2119185C    
           hemoglobin:SUBUNIT=beta - Meleagris gallopavo (common
           turkey)
          Length = 146

 Score = 42.7 bits (99), Expect = 0.004
 Identities = 35/132 (26%), Positives = 56/132 (41%), Gaps = 2/132 (1%)
 Frame = +1

Query: 115 SSHERSLIRKTWDQAKKDGDVAPQVLFRFVKAHPEYQKMFSKFANVPQ-AELLSNGNFLA 291
           S+ E+ LI   W +     D   + L R +  +P  Q+ F+ F N+     +L N    A
Sbjct: 4   SAEEKQLITGLWGKVNV-ADCGAEALARLLIVYPWTQRFFASFGNLSSPTAILGNPMVRA 62

Query: 292 QAYTILAGLNVVIQSLSSQELMANQLNALGGAHKPR-GATPVMFEQFGGILEEVLAEELG 468
               +L      +++L + +   +QL+ L   H  +    P  F   G IL  VLA    
Sbjct: 63  HGKKVLTSFGDAVKNLDNIKNTFSQLSEL---HCDKLHVDPENFRLLGDILIIVLAAHFS 119

Query: 469 SGFTAEARQAWK 504
             FT E + AW+
Sbjct: 120 KDFTPECQAAWQ 131


  Database: nr-aa
    Posted date:  Jul 23, 2004  4:17 PM
  Number of letters in database: 498,469,568
  Number of sequences in database:  1,542,475
  
Lambda     K      H
   0.314    0.130    0.362 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 525,786,581
Number of Sequences: 1542475
Number of extensions: 12286961
Number of successful extensions: 46901
Number of sequences better than 10.0: 896
Number of HSP's better than 10.0 without gapping: 44041
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 46780
length of database: 498,469,568
effective HSP length: 117
effective length of database: 317,999,993
effective search space used: 23849999475
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.5 bits)